BLASTX nr result
ID: Papaver32_contig00041414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00041414 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT51347.1 Two pore calcium channel protein 1A [Anthurium amnicola] 55 7e-06 >JAT51347.1 Two pore calcium channel protein 1A [Anthurium amnicola] Length = 748 Score = 54.7 bits (130), Expect = 7e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 4/47 (8%) Frame = -2 Query: 268 LVHVIFLMILVADVLVYAL----VPVNSLPLRIAPYIGVIFVILNCR 140 ++ VIFL +LV D+LVYAL VPVN LPLR+APYI V F+ +N R Sbjct: 168 ILKVIFLFLLVCDLLVYALYLSPVPVNYLPLRVAPYIRVAFIAINIR 214