BLASTX nr result
ID: Papaver32_contig00041264
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00041264 (560 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010263827.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-07 >XP_010263827.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Nelumbo nucifera] Length = 436 Score = 59.7 bits (143), Expect = 3e-07 Identities = 33/118 (27%), Positives = 62/118 (52%), Gaps = 3/118 (2%) Frame = -2 Query: 355 PCLFNRLKFHSVYCVFPGLKRELQANYKRDLLNLVPKVSNTESHHPDTQSDDDDITEVWE 176 PC L F S Y V+ G EL A KR ++ ++ + D + Sbjct: 24 PCPSAPLHFRS-YGVYNGFAMELHAKKKRGIVGVLRVSQRNAGYVQGGNRLAYDFKSLCR 82 Query: 175 EGKI---IDFIDDVEKKGECLDNDSLISIIQACIESNSLVSGRRILDYVMGSSRKSSL 11 EG++ ++ +DD+E++G C+D +SL+++++AC+ L +GR++ DY+ S + S+ Sbjct: 83 EGRVEAALELLDDMERRGICVDTNSLVALLEACVNFKLLEAGRKVHDYINKSIPRPSI 140