BLASTX nr result
ID: Papaver32_contig00039655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00039655 (478 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AOO87126.1 histidinol dehydrogenase [Kalanchoe daigremontiana] 62 3e-08 AAM65533.1 histidinol dehydrogenase [Arabidopsis thaliana] 61 6e-08 XP_018846002.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 61 6e-08 XP_010485306.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 61 6e-08 NP_851260.1 histidinol dehydrogenase [Arabidopsis thaliana] AED9... 61 6e-08 NP_568981.2 histidinol dehydrogenase [Arabidopsis thaliana] Q9C5... 61 7e-08 BAB11037.1 histidinol dehydrogenase [Arabidopsis thaliana] 61 7e-08 XP_006280418.1 hypothetical protein CARUB_v10026351mg [Capsella ... 61 7e-08 XP_002866581.1 predicted protein [Arabidopsis lyrata subsp. lyra... 61 7e-08 XP_010444311.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 61 7e-08 XP_010461119.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 61 7e-08 XP_018846000.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 61 7e-08 OMO98760.1 Histidinol dehydrogenase [Corchorus olitorius] 61 7e-08 OMO89233.1 Histidinol dehydrogenase [Corchorus capsularis] 61 7e-08 ONM09991.1 Histidinol dehydrogenase chloroplastic [Zea mays] 60 9e-08 XP_015699134.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 60 1e-07 XP_015618412.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 60 1e-07 BAJ97540.1 predicted protein [Hordeum vulgare subsp. vulgare] 60 1e-07 GAV63081.1 Histidinol_dh domain-containing protein [Cephalotus f... 60 1e-07 XP_003562434.1 PREDICTED: histidinol dehydrogenase, chloroplasti... 60 1e-07 >AOO87126.1 histidinol dehydrogenase [Kalanchoe daigremontiana] Length = 483 Score = 62.0 bits (149), Expect = 3e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCKIVVLATPP KDG+ICK Sbjct: 181 TALMLAVPAQIAGCKIVVLATPPSKDGNICK 211 >AAM65533.1 histidinol dehydrogenase [Arabidopsis thaliana] Length = 435 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 135 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 165 >XP_018846002.1 PREDICTED: histidinol dehydrogenase, chloroplastic isoform X2 [Juglans regia] XP_018846003.1 PREDICTED: histidinol dehydrogenase, chloroplastic isoform X2 [Juglans regia] Length = 438 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALML+VPAQIAGCK VVLATPPG+DGSICK Sbjct: 135 TALMLSVPAQIAGCKTVVLATPPGQDGSICK 165 >XP_010485306.1 PREDICTED: histidinol dehydrogenase, chloroplastic [Camelina sativa] Length = 441 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 167 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 197 >NP_851260.1 histidinol dehydrogenase [Arabidopsis thaliana] AED97811.1 histidinol dehydrogenase [Arabidopsis thaliana] Length = 452 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 152 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 182 >NP_568981.2 histidinol dehydrogenase [Arabidopsis thaliana] Q9C5U8.1 RecName: Full=Histidinol dehydrogenase, chloroplastic; Short=HDH; AltName: Full=Protein HISTIDINE BIOSYNTHESIS 8; Flags: Precursor BAB40445.1 histidinol dehydrogenase [Arabidopsis thaliana] AAK63985.1 AT5g63890/MGI19_9 [Arabidopsis thaliana] AAN28839.1 At5g63890/MGI19_9 [Arabidopsis thaliana] AED97812.1 histidinol dehydrogenase [Arabidopsis thaliana] OAO95588.1 HISN8 [Arabidopsis thaliana] Length = 466 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 166 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 196 >BAB11037.1 histidinol dehydrogenase [Arabidopsis thaliana] Length = 467 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 167 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 197 >XP_006280418.1 hypothetical protein CARUB_v10026351mg [Capsella rubella] EOA13316.1 hypothetical protein CARUB_v10026351mg [Capsella rubella] Length = 469 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 166 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 196 >XP_002866581.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH42840.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 469 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 166 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 196 >XP_010444311.1 PREDICTED: histidinol dehydrogenase, chloroplastic-like [Camelina sativa] Length = 470 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 167 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 197 >XP_010461119.1 PREDICTED: histidinol dehydrogenase, chloroplastic [Camelina sativa] Length = 470 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLA+PAQIAGCK VVLATPP KDGSICK Sbjct: 167 TALMLAIPAQIAGCKTVVLATPPSKDGSICK 197 >XP_018846000.1 PREDICTED: histidinol dehydrogenase, chloroplastic isoform X1 [Juglans regia] XP_018846001.1 PREDICTED: histidinol dehydrogenase, chloroplastic isoform X1 [Juglans regia] Length = 483 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALML+VPAQIAGCK VVLATPPG+DGSICK Sbjct: 180 TALMLSVPAQIAGCKTVVLATPPGQDGSICK 210 >OMO98760.1 Histidinol dehydrogenase [Corchorus olitorius] Length = 491 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALML+VPAQIAGCK VVLATPPG+DGSICK Sbjct: 188 TALMLSVPAQIAGCKTVVLATPPGQDGSICK 218 >OMO89233.1 Histidinol dehydrogenase [Corchorus capsularis] Length = 491 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALML+VPAQIAGCK VVLATPPG+DGSICK Sbjct: 188 TALMLSVPAQIAGCKTVVLATPPGQDGSICK 218 >ONM09991.1 Histidinol dehydrogenase chloroplastic [Zea mays] Length = 245 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCK +VLATPP +DGSICK Sbjct: 176 TALMLAVPAQIAGCKTIVLATPPSRDGSICK 206 >XP_015699134.1 PREDICTED: histidinol dehydrogenase, chloroplastic [Oryza brachyantha] Length = 471 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCK VVLATPP +DGSICK Sbjct: 171 TALMLAVPAQIAGCKTVVLATPPSRDGSICK 201 >XP_015618412.1 PREDICTED: histidinol dehydrogenase, chloroplastic [Oryza sativa Japonica Group] Q5NAY4.1 RecName: Full=Histidinol dehydrogenase, chloroplastic; Short=HDH; Flags: Precursor BAD81372.1 putative histidinol dehydrogenase precursor, chloroplast [Oryza sativa Japonica Group] BAF04420.1 Os01g0232700 [Oryza sativa Japonica Group] EAY73160.1 hypothetical protein OsI_01033 [Oryza sativa Indica Group] EAZ11153.1 hypothetical protein OsJ_01002 [Oryza sativa Japonica Group] BAG91705.1 unnamed protein product [Oryza sativa Japonica Group] BAS71191.1 Os01g0232700 [Oryza sativa Japonica Group] Length = 473 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCK VVLATPP +DGSICK Sbjct: 173 TALMLAVPAQIAGCKTVVLATPPSRDGSICK 203 >BAJ97540.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 475 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCK VVLATPP +DGSICK Sbjct: 175 TALMLAVPAQIAGCKTVVLATPPSRDGSICK 205 >GAV63081.1 Histidinol_dh domain-containing protein [Cephalotus follicularis] Length = 487 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALML+VPAQIAGCK VVLATPP KDGSICK Sbjct: 184 TALMLSVPAQIAGCKTVVLATPPSKDGSICK 214 >XP_003562434.1 PREDICTED: histidinol dehydrogenase, chloroplastic [Brachypodium distachyon] KQK14570.1 hypothetical protein BRADI_1g17340 [Brachypodium distachyon] Length = 491 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 475 TALMLAVPAQIAGCKIVVLATPPGKDGSICK 383 TALMLAVPAQIAGCK VVLATPP +DGSICK Sbjct: 191 TALMLAVPAQIAGCKTVVLATPPSRDGSICK 221