BLASTX nr result
ID: Papaver32_contig00036894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00036894 (1129 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ELK24237.1 hypothetical protein MDA_GLEAN10017786 [Myotis davidii] 55 1e-05 >ELK24237.1 hypothetical protein MDA_GLEAN10017786 [Myotis davidii] Length = 155 Score = 55.5 bits (132), Expect = 1e-05 Identities = 29/85 (34%), Positives = 41/85 (48%) Frame = -2 Query: 618 PATAIQHHIKHQSHLQFQLYCNHQHLLRATTRTTNSNFIYITSSIPPAISQRTPTPYQHH 439 P+T+ HH +HQ H + +H HL TTN I+ T++ PP S +P P HH Sbjct: 25 PSTSTSHHHQHQHHHHHHHHQHHHHLHNHHLTTTNITTIFTTTTSPPPTSPSSPQPPPHH 84 Query: 438 *SHML*QQRHPLLRRFLIFITATFN 364 H Q+ P + + IT T N Sbjct: 85 HHHHHHHQQQPTITTNSVTITITNN 109