BLASTX nr result
ID: Papaver32_contig00036596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00036596 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010267538.1 PREDICTED: protein phosphatase 2C 57 [Nelumbo nuc... 60 7e-08 GAV89093.1 PP2C domain-containing protein [Cephalotus follicularis] 55 7e-06 >XP_010267538.1 PREDICTED: protein phosphatase 2C 57 [Nelumbo nucifera] Length = 383 Score = 60.5 bits (145), Expect = 7e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +2 Query: 314 LQKFLLNGISYHSVLKTKKNNIYRERKTCCSAIVIDSPSSLTGVSGIRWG 463 LQ+FLLNGI S LK +K + +RER CSAI ID+PSSL G +GIRWG Sbjct: 8 LQRFLLNGIICSSGLKARKKS-FRERIRSCSAIAIDAPSSLAGAAGIRWG 56 >GAV89093.1 PP2C domain-containing protein [Cephalotus follicularis] Length = 395 Score = 54.7 bits (130), Expect = 7e-06 Identities = 30/62 (48%), Positives = 37/62 (59%), Gaps = 12/62 (19%) Frame = +2 Query: 314 LQKFLLNGISYHSVLKT---KKNNIY---------RERKTCCSAIVIDSPSSLTGVSGIR 457 LQ+FLL + Y+S KT + NN Y R + CCSAI ID+PSS T V+GIR Sbjct: 8 LQRFLLTKLHYNSNFKTTTTRNNNSYNHLGTSTSARPKSQCCSAIAIDAPSSFTDVAGIR 67 Query: 458 WG 463 WG Sbjct: 68 WG 69