BLASTX nr result
ID: Papaver32_contig00036570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00036570 (741 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAA84682.1 unknown protein (chloroplast) [Nicotiana tabacum] prf... 77 5e-15 EYU35473.1 hypothetical protein MIMGU_mgv11b021317mg [Erythranth... 55 1e-06 >AAA84682.1 unknown protein (chloroplast) [Nicotiana tabacum] prf||1102209F ORF 6 Length = 79 Score = 77.4 bits (189), Expect = 5e-15 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +1 Query: 22 MKVDYLPIHFKTSTISSRTKHESFNSFGSHAQLLNKGFH--FFLCNEPILSSLFVFQ 186 MKVDY I F+ S I SRTKHESF+SFGSHAQLL H F+ CNEPI SSLF+FQ Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFFYECNEPIFSSLFIFQ 57 >EYU35473.1 hypothetical protein MIMGU_mgv11b021317mg [Erythranthe guttata] Length = 70 Score = 54.7 bits (130), Expect = 1e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 22 MKVDYLPIHFKTSTISSRTKHESFNSFGSHAQLL 123 MKVDYL +HFK S I SRTKHES +SFGSH QLL Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLL 34