BLASTX nr result
ID: Papaver32_contig00027087
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00027087 (999 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006374308.1 hypothetical protein POPTR_0015s05900g, partial [... 56 9e-07 ACF82744.1 unknown [Zea mays] 55 1e-06 CDY51663.1 BnaC03g67020D [Brassica napus] 54 3e-06 AFK37844.1 unknown [Medicago truncatula] 56 3e-06 KDO71106.1 hypothetical protein CISIN_1g0010461mg, partial [Citr... 55 5e-06 XP_007212060.1 hypothetical protein PRUPE_ppa011497mg [Prunus pe... 57 7e-06 >XP_006374308.1 hypothetical protein POPTR_0015s05900g, partial [Populus trichocarpa] ERP52105.1 hypothetical protein POPTR_0015s05900g, partial [Populus trichocarpa] Length = 83 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL+E APR FK +D +KM+K+KR ERI PL YHEP+S L K+RA Sbjct: 37 WLVELAPRFFKVSDPTKMSKRKRHERIEPLYDRYHEPNSCRLSKRRA 83 >ACF82744.1 unknown [Zea mays] Length = 63 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL+E APR +K D +KM+K+KR+ERI PL YHEP+S L K+RA Sbjct: 17 WLVELAPRFYKGADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 63 >CDY51663.1 BnaC03g67020D [Brassica napus] Length = 63 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL+E APR FK D + M+K+KR+ERI PL YHEP+S L K+RA Sbjct: 17 WLVELAPRFFKVADPTHMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 63 >AFK37844.1 unknown [Medicago truncatula] Length = 133 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL+E APR FK D +KM+K+KR+ER+ PL YHEP+S L K+RA Sbjct: 87 WLVELAPRFFKVADPTKMSKRKRQERVEPLYDRYHEPNSWRLSKRRA 133 >KDO71106.1 hypothetical protein CISIN_1g0010461mg, partial [Citrus sinensis] Length = 130 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL++ APR FK D +KM+K+KR+ERI PL YHEP+S L K+RA Sbjct: 84 WLVDLAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 130 >XP_007212060.1 hypothetical protein PRUPE_ppa011497mg [Prunus persica] ONI21638.1 hypothetical protein PRUPE_2G077500 [Prunus persica] Length = 208 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 3/47 (6%) Frame = -3 Query: 997 WLIEFAPRSFKATDTSKMTKQKRKERIMPL---YHEPDSRCLRKQRA 866 WL+E APR FK D +KM+K+KR+ERI PL YHEP+S L K+RA Sbjct: 162 WLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA 208