BLASTX nr result
ID: Papaver32_contig00024581
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00024581 (502 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM86119.1 hypothetical protein DCAR_026459 [Daucus carota subsp... 64 6e-09 XP_010655948.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 59 1e-07 XP_016553406.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 60 1e-07 XP_006368884.1 hypothetical protein POPTR_0001s13880g [Populus t... 60 1e-07 XP_002299305.2 hypothetical protein POPTR_0001s13880g [Populus t... 60 1e-07 XP_006368885.1 hypothetical protein POPTR_0001s13880g [Populus t... 60 1e-07 XP_016553405.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 60 2e-07 XP_002277426.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 59 2e-07 XP_010655942.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 59 2e-07 XP_010278486.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 59 2e-07 CBI27663.3 unnamed protein product, partial [Vitis vinifera] 59 2e-07 XP_010252167.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 59 3e-07 KVI05712.1 Zinc finger, RanBP2-type [Cynara cardunculus var. sco... 59 3e-07 XP_011086804.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 58 3e-07 XP_002303795.1 hypothetical protein POPTR_0003s17100g, partial [... 59 3e-07 ONI29973.1 hypothetical protein PRUPE_1G225000 [Prunus persica] 59 4e-07 ONI29974.1 hypothetical protein PRUPE_1G225000 [Prunus persica] 59 4e-07 ONI29975.1 hypothetical protein PRUPE_1G225000 [Prunus persica] 59 4e-07 ONI29976.1 hypothetical protein PRUPE_1G225000 [Prunus persica] 59 4e-07 XP_011086803.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 58 5e-07 >KZM86119.1 hypothetical protein DCAR_026459 [Daucus carota subsp. sativus] Length = 369 Score = 63.9 bits (154), Expect = 6e-09 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ*VLEPLLRFEKVQSRRRSAL 3 INYPFR KCNRQNCGA+KPS+S SP + P +++DQ LR EKVQS R + L Sbjct: 297 INYPFRTKCNRQNCGADKPSDSKKSP-SEPVDDNDQ----ACLRVEKVQSCRSALL 347 >XP_010655948.1 PREDICTED: ranBP2-type zinc finger protein At1g67325 isoform X3 [Vitis vinifera] Length = 229 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGA+KPSES SP P E D Sbjct: 195 INYPFRTKCNRQNCGADKPSESTKSPSPSPDEND 228 >XP_016553406.1 PREDICTED: ranBP2-type zinc finger protein At1g67325 isoform X2 [Capsicum annuum] Length = 284 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGAEKPSES NSP + ++E DQ Sbjct: 250 INYPFRTKCNRQNCGAEKPSESKNSP-SQSADETDQ 284 >XP_006368884.1 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] XP_011002131.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X2 [Populus euphratica] ERP65453.1 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 284 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGAEKP+ES SP P E+D Sbjct: 250 INYPFRTKCNRQNCGAEKPAESKKSPSPAPDEDD 283 >XP_002299305.2 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] EEE84110.2 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 287 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGAEKP+ES SP P E+D Sbjct: 246 INYPFRTKCNRQNCGAEKPAESKKSPSPAPDEDD 279 >XP_006368885.1 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] XP_011002130.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X1 [Populus euphratica] ERP65454.1 hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 291 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGAEKP+ES SP P E+D Sbjct: 250 INYPFRTKCNRQNCGAEKPAESKKSPSPAPDEDD 283 >XP_016553405.1 PREDICTED: ranBP2-type zinc finger protein At1g67325 isoform X1 [Capsicum annuum] Length = 334 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGAEKPSES NSP + ++E DQ Sbjct: 250 INYPFRTKCNRQNCGAEKPSESKNSP-SQSADETDQ 284 >XP_002277426.1 PREDICTED: ranBP2-type zinc finger protein At1g67325 isoform X2 [Vitis vinifera] Length = 282 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGA+KPSES SP P E D Sbjct: 248 INYPFRTKCNRQNCGADKPSESTKSPSPSPDEND 281 >XP_010655942.1 PREDICTED: ranBP2-type zinc finger protein At1g67325 isoform X1 [Vitis vinifera] Length = 285 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGA+KPSES SP P E D Sbjct: 251 INYPFRTKCNRQNCGADKPSESTKSPSPSPDEND 284 >XP_010278486.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Nelumbo nucifera] Length = 285 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/69 (44%), Positives = 37/69 (53%) Frame = -3 Query: 500 LSGGSPYPPMHLXXXXXXXXXXXXXXXXXXXXXXXXXXPIMDRFGLGLPMGHTPMGSRPG 321 LS GSPY P+HL +MDR+GLGLPMGHT MG+RPG Sbjct: 123 LSVGSPYGPLHLSGPPPYSSGSMLGTGGMYGMAP-----LMDRYGLGLPMGHTAMGARPG 177 Query: 320 LFQDENPPR 294 +F DENP + Sbjct: 178 VFPDENPQK 186 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGAEKPSE+N SP SE++ Sbjct: 251 INYPFRTKCNRQNCGAEKPSETNKSPSPSSSEDE 284 >CBI27663.3 unnamed protein product, partial [Vitis vinifera] Length = 287 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEED 69 INYPFR KCNRQNCGA+KPSES SP P E D Sbjct: 248 INYPFRTKCNRQNCGADKPSESTKSPSPSPDEND 281 >XP_010252167.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Nelumbo nucifera] Length = 283 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGAEKPSE++ SP A S++D+Q Sbjct: 249 INYPFRTKCNRQNCGAEKPSETSKSP-AQTSDDDEQ 283 >KVI05712.1 Zinc finger, RanBP2-type [Cynara cardunculus var. scolymus] Length = 431 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGAEKPSES SP + +EE+DQ Sbjct: 338 INYPFRTKCNRQNCGAEKPSESQKSP-SEEAEENDQ 372 >XP_011086804.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X2 [Sesamum indicum] Length = 226 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KPSE+ SP P++E+DQ Sbjct: 192 INYPFRTKCNRQNCGADKPSETKKSP-QEPADENDQ 226 >XP_002303795.1 hypothetical protein POPTR_0003s17100g, partial [Populus trichocarpa] EEE78774.1 hypothetical protein POPTR_0003s17100g, partial [Populus trichocarpa] Length = 283 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSE 75 INYPFR KCNRQNCGAEKPSES SP P E Sbjct: 249 INYPFRTKCNRQNCGAEKPSESTKSPSPEPDE 280 >ONI29973.1 hypothetical protein PRUPE_1G225000 [Prunus persica] Length = 311 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KP+ES SP P E D + Sbjct: 251 INYPFRTKCNRQNCGADKPAESKKSPSPAPDENDQE 286 >ONI29974.1 hypothetical protein PRUPE_1G225000 [Prunus persica] Length = 312 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KP+ES SP P E D + Sbjct: 252 INYPFRTKCNRQNCGADKPAESKKSPSPAPDENDQE 287 >ONI29975.1 hypothetical protein PRUPE_1G225000 [Prunus persica] Length = 321 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KP+ES SP P E D + Sbjct: 261 INYPFRTKCNRQNCGADKPAESKKSPSPAPDENDQE 296 >ONI29976.1 hypothetical protein PRUPE_1G225000 [Prunus persica] Length = 322 Score = 58.5 bits (140), Expect = 4e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KP+ES SP P E D + Sbjct: 262 INYPFRTKCNRQNCGADKPAESKKSPSPAPDENDQE 297 >XP_011086803.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X1 [Sesamum indicum] Length = 282 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 170 INYPFRAKCNRQNCGAEKPSESNNSPVAHPSEEDDQ 63 INYPFR KCNRQNCGA+KPSE+ SP P++E+DQ Sbjct: 248 INYPFRTKCNRQNCGADKPSETKKSP-QEPADENDQ 282