BLASTX nr result
ID: Papaver32_contig00023982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00023982 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009791525.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_016481901.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_009617173.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_019229967.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_006364578.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_015070231.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_004235983.1 PREDICTED: two-component response regulator-like ... 74 3e-12 XP_016563266.1 PREDICTED: two-component response regulator-like ... 72 8e-12 XP_004299333.1 PREDICTED: two-component response regulator-like ... 72 8e-12 XP_016563264.1 PREDICTED: two-component response regulator-like ... 72 8e-12 XP_016192971.1 PREDICTED: two-component response regulator-like ... 72 8e-12 XP_015942947.1 PREDICTED: two-component response regulator-like ... 72 8e-12 AAU20772.1 timing of CAB expression 1 protein [Castanea sativa] 72 1e-11 KZV34697.1 CCT motif-containing response regulator protein isofo... 71 2e-11 KVH98857.1 CCT domain-containing protein [Cynara cardunculus var... 71 2e-11 AEA50889.1 toc1, partial [Populus tremula] 70 3e-11 XP_012080307.1 PREDICTED: two-component response regulator-like ... 71 3e-11 KVH98515.1 CCT domain-containing protein [Cynara cardunculus var... 71 3e-11 XP_012080306.1 PREDICTED: two-component response regulator-like ... 71 3e-11 XP_010547769.1 PREDICTED: two-component response regulator-like ... 70 4e-11 >XP_009791525.1 PREDICTED: two-component response regulator-like APRR1 [Nicotiana sylvestris] XP_016500540.1 PREDICTED: two-component response regulator-like APRR1 [Nicotiana tabacum] Length = 544 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 479 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 519 >XP_016481901.1 PREDICTED: two-component response regulator-like APRR1 [Nicotiana tabacum] Length = 548 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 478 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 518 >XP_009617173.1 PREDICTED: two-component response regulator-like APRR1 [Nicotiana tomentosiformis] Length = 548 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 478 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 518 >XP_019229967.1 PREDICTED: two-component response regulator-like APRR1 [Nicotiana attenuata] AFA35965.1 timing of cab expression 1/pseudo-response regulator 1 [Nicotiana attenuata] OIT29753.1 two-component response regulator-like aprr1 [Nicotiana attenuata] Length = 551 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 480 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 520 >XP_006364578.1 PREDICTED: two-component response regulator-like APRR1 [Solanum tuberosum] Length = 552 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 483 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 523 >XP_015070231.1 PREDICTED: two-component response regulator-like APRR1 [Solanum pennellii] Length = 553 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 483 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 523 >XP_004235983.1 PREDICTED: two-component response regulator-like APRR1 [Solanum lycopersicum] Length = 553 Score = 73.6 bits (179), Expect = 3e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHPA+ Sbjct: 483 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGHPAS 523 >XP_016563266.1 PREDICTED: two-component response regulator-like APRR1 isoform X2 [Capsicum annuum] Length = 507 Score = 72.4 bits (176), Expect = 8e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV V+LNGHPA+ Sbjct: 436 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVRVDLNGHPAS 476 >XP_004299333.1 PREDICTED: two-component response regulator-like APRR1 [Fragaria vesca subsp. vesca] Length = 536 Score = 72.4 bits (176), Expect = 8e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGVDV+LNG PA+ Sbjct: 479 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVDVDLNGQPAS 519 >XP_016563264.1 PREDICTED: two-component response regulator-like APRR1 isoform X1 [Capsicum annuum] XP_016563265.1 PREDICTED: two-component response regulator-like APRR1 isoform X1 [Capsicum annuum] Length = 551 Score = 72.4 bits (176), Expect = 8e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV V+LNGHPA+ Sbjct: 480 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVRVDLNGHPAS 520 >XP_016192971.1 PREDICTED: two-component response regulator-like APRR1 [Arachis ipaensis] Length = 574 Score = 72.4 bits (176), Expect = 8e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R++NGV+V+LNGHPA+ Sbjct: 508 FDKKIRYVNRKRLAERRPRVRGQFVRKLNGVNVDLNGHPAS 548 >XP_015942947.1 PREDICTED: two-component response regulator-like APRR1 [Arachis duranensis] Length = 575 Score = 72.4 bits (176), Expect = 8e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R++NGV+V+LNGHPA+ Sbjct: 509 FDKKIRYVNRKRLAERRPRVRGQFVRKLNGVNVDLNGHPAS 549 >AAU20772.1 timing of CAB expression 1 protein [Castanea sativa] Length = 545 Score = 72.0 bits (175), Expect = 1e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNGHP + Sbjct: 490 FDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGHPTS 530 >KZV34697.1 CCT motif-containing response regulator protein isoform 2 [Dorcoceras hygrometricum] Length = 508 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPATP 128 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNG P +P Sbjct: 437 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPPSP 478 >KVH98857.1 CCT domain-containing protein [Cynara cardunculus var. scolymus] Length = 593 Score = 71.2 bits (173), Expect = 2e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR R+RGQF+R+VNG++V+LNGHP + Sbjct: 531 FDKKIRYVNRKKLAERRPRIRGQFVRKVNGINVDLNGHPTS 571 >AEA50889.1 toc1, partial [Populus tremula] Length = 336 Score = 70.5 bits (171), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNG PA+ Sbjct: 268 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPAS 308 >XP_012080307.1 PREDICTED: two-component response regulator-like APRR1 isoform X2 [Jatropha curcas] Length = 473 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNG P+T Sbjct: 406 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPST 446 >KVH98515.1 CCT domain-containing protein [Cynara cardunculus var. scolymus] Length = 534 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKK+RYVNRK LAERR RVRGQF+R++NG++V+LNGHP + Sbjct: 475 FDKKVRYVNRKKLAERRPRVRGQFVRKINGINVDLNGHPTS 515 >XP_012080306.1 PREDICTED: two-component response regulator-like APRR1 isoform X1 [Jatropha curcas] KDP31283.1 hypothetical protein JCGZ_11659 [Jatropha curcas] Length = 556 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNG P+T Sbjct: 489 FDKKIRYVNRKKLAERRPRVRGQFVRKVNGVNVDLNGQPST 529 >XP_010547769.1 PREDICTED: two-component response regulator-like APRR1 isoform X2 [Tarenaya hassleriana] Length = 533 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 FDKKIRYVNRKTLAERRARVRGQFMRQVNGVDVNLNGHPAT 125 FDKKIRYVNRK LAERR RVRGQF+R+VNGV+V+LNG PA+ Sbjct: 466 FDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPAS 506