BLASTX nr result
ID: Papaver32_contig00023549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00023549 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH67395.1 hypothetical protein GLYMA_03G163900 [Glycine max] 58 8e-07 KRH67392.1 hypothetical protein GLYMA_03G163900 [Glycine max] 58 8e-07 XP_014629316.1 PREDICTED: U-box domain-containing protein 3-like... 58 8e-07 KHN02500.1 U-box domain-containing protein 3 [Glycine soja] 57 3e-06 KRG95671.1 hypothetical protein GLYMA_19G165200 [Glycine max] 57 3e-06 XP_006604492.1 PREDICTED: U-box domain-containing protein 3-like... 57 3e-06 XP_010101417.1 U-box domain-containing protein 3 [Morus notabili... 57 3e-06 KRG95673.1 hypothetical protein GLYMA_19G165200 [Glycine max] 57 3e-06 XP_012483358.1 PREDICTED: U-box domain-containing protein 3-like... 56 3e-06 XP_012483351.1 PREDICTED: U-box domain-containing protein 3-like... 56 4e-06 XP_016745740.1 PREDICTED: U-box domain-containing protein 3-like... 56 4e-06 XP_012483324.1 PREDICTED: U-box domain-containing protein 3-like... 56 4e-06 XP_012483319.1 PREDICTED: U-box domain-containing protein 3-like... 56 4e-06 XP_012483311.1 PREDICTED: U-box domain-containing protein 3-like... 56 4e-06 KYP70744.1 U-box domain-containing protein 3, partial [Cajanus c... 56 5e-06 KJB11338.1 hypothetical protein B456_001G254100 [Gossypium raimo... 55 6e-06 XP_016746707.1 PREDICTED: U-box domain-containing protein 3-like... 55 6e-06 XP_016749956.1 PREDICTED: U-box domain-containing protein 3-like... 55 6e-06 XP_012442835.1 PREDICTED: U-box domain-containing protein 3-like... 55 6e-06 EOX94436.1 ARM repeat superfamily protein isoform 2 [Theobroma c... 55 7e-06 >KRH67395.1 hypothetical protein GLYMA_03G163900 [Glycine max] Length = 760 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REGV GK KS Sbjct: 727 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 760 >KRH67392.1 hypothetical protein GLYMA_03G163900 [Glycine max] Length = 792 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REGV GK KS Sbjct: 759 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 792 >XP_014629316.1 PREDICTED: U-box domain-containing protein 3-like isoform X5 [Glycine max] Length = 793 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REGV GK KS Sbjct: 760 ALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 793 >KHN02500.1 U-box domain-containing protein 3 [Glycine soja] Length = 774 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 741 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 774 >KRG95671.1 hypothetical protein GLYMA_19G165200 [Glycine max] Length = 795 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 762 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 795 >XP_006604492.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Glycine max] Length = 796 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 763 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 796 >XP_010101417.1 U-box domain-containing protein 3 [Morus notabilis] EXB88383.1 U-box domain-containing protein 3 [Morus notabilis] Length = 807 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 774 ALSQSGTPRAKEKAQQLLSHFRNQREGTTGKGKS 807 >KRG95673.1 hypothetical protein GLYMA_19G165200 [Glycine max] Length = 812 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 779 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 812 >XP_012483358.1 PREDICTED: U-box domain-containing protein 3-like isoform X5 [Gossypium raimondii] Length = 650 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 615 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 647 >XP_012483351.1 PREDICTED: U-box domain-containing protein 3-like isoform X4 [Gossypium raimondii] Length = 675 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 640 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 672 >XP_016745740.1 PREDICTED: U-box domain-containing protein 3-like [Gossypium hirsutum] XP_016745741.1 PREDICTED: U-box domain-containing protein 3-like [Gossypium hirsutum] Length = 777 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 742 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 774 >XP_012483324.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Gossypium raimondii] XP_012483331.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Gossypium raimondii] XP_012483338.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Gossypium raimondii] XP_012483344.1 PREDICTED: U-box domain-containing protein 3-like isoform X3 [Gossypium raimondii] KJB09959.1 hypothetical protein B456_001G178000 [Gossypium raimondii] KJB09960.1 hypothetical protein B456_001G178000 [Gossypium raimondii] Length = 777 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 742 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 774 >XP_012483319.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium raimondii] KJB09958.1 hypothetical protein B456_001G178000 [Gossypium raimondii] Length = 792 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 757 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 789 >XP_012483311.1 PREDICTED: U-box domain-containing protein 3-like isoform X1 [Gossypium raimondii] KJB09962.1 hypothetical protein B456_001G178000 [Gossypium raimondii] Length = 793 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+LGHFR++REG GKA+ Sbjct: 758 ALSQSGTPRAKEKAQQLLGHFRNQREGSMGKAR 790 >KYP70744.1 U-box domain-containing protein 3, partial [Cajanus cajan] Length = 745 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK KS Sbjct: 712 ALSQSGTPRAKEKAQQLLSHFRNQREGAMGKGKS 745 >KJB11338.1 hypothetical protein B456_001G254100 [Gossypium raimondii] Length = 590 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+L HFR++REG GK+K Sbjct: 558 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 590 >XP_016746707.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium hirsutum] Length = 681 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+L HFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >XP_016749956.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium hirsutum] Length = 681 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+L HFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >XP_012442835.1 PREDICTED: U-box domain-containing protein 3-like isoform X2 [Gossypium raimondii] KJB11341.1 hypothetical protein B456_001G254100 [Gossypium raimondii] Length = 681 Score = 55.5 bits (132), Expect = 6e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAK 101 ALS SGTPRAKEKAQQ+L HFR++REG GK+K Sbjct: 649 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKSK 681 >EOX94436.1 ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 750 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 ALSMSGTPRAKEKAQQILGHFRDRREGVNGKAKS 104 ALS SGTPRAKEKAQQ+L HFR++REG GK K+ Sbjct: 717 ALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 750