BLASTX nr result
ID: Papaver32_contig00023202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00023202 (973 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010251683.1 PREDICTED: UBP1-associated protein 2A [Nelumbo nu... 79 9e-13 XP_010943670.1 PREDICTED: UBP1-associated protein 2A-like [Elaei... 62 5e-07 >XP_010251683.1 PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] XP_010251684.1 PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] XP_010251685.1 PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera] Length = 508 Score = 79.3 bits (194), Expect = 9e-13 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 2/43 (4%) Frame = +1 Query: 1 MAGYGTQPGMQGGYQNP-MGQPNAGRSQQG-GHMGGVPPYMGH 123 MAGYG QPGMQGGY NP MGQPNAGRSQQG GHMGGV PYMGH Sbjct: 466 MAGYGNQPGMQGGYPNPQMGQPNAGRSQQGVGHMGGVAPYMGH 508 >XP_010943670.1 PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis] XP_010943671.1 PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis] Length = 511 Score = 62.0 bits (149), Expect = 5e-07 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 2/43 (4%) Frame = +1 Query: 1 MAGYGTQPGMQGGYQN-PMGQPNAGRSQQG-GHMGGVPPYMGH 123 M GYG Q GMQGGY N MGQ AGR+QQG GHMGGV PY GH Sbjct: 469 MGGYGAQAGMQGGYGNAQMGQGGAGRNQQGLGHMGGVTPYKGH 511