BLASTX nr result
ID: Papaver32_contig00022792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00022792 (1094 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009397374.1 PREDICTED: vacuolar protein sorting-associated pr... 58 4e-06 XP_004488205.1 PREDICTED: vacuolar protein sorting-associated pr... 57 5e-06 GAU48625.1 hypothetical protein TSUD_405840 [Trifolium subterran... 57 5e-06 CDP12610.1 unnamed protein product [Coffea canephora] 57 6e-06 XP_010904643.1 PREDICTED: vacuolar protein sorting-associated pr... 57 6e-06 XP_009408560.1 PREDICTED: vacuolar protein sorting-associated pr... 57 8e-06 KHN45569.1 Vacuolar protein sorting-associated protein 2 like 2 ... 56 8e-06 KHN41461.1 Vacuolar protein sorting-associated protein 2 like 2 ... 56 8e-06 KYP37687.1 Vacuolar protein sorting-associated protein 2 isogeny... 56 8e-06 CBI39020.3 unnamed protein product, partial [Vitis vinifera] 57 1e-05 XP_018828522.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 XP_017240997.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 XP_012075551.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 XP_002277559.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 XP_015954900.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 XP_015954899.1 PREDICTED: vacuolar protein sorting-associated pr... 57 1e-05 >XP_009397374.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Musa acuminata subsp. malaccensis] Length = 220 Score = 57.8 bits (138), Expect = 4e-06 Identities = 36/71 (50%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNN----DVPLILSTAQLE*AAVTE 373 +S Q +EM+SE+IDETLDKD AEEETEELTNQV + DV LS+A AV+ Sbjct: 131 QSSQMDMTLEMMSEAIDETLDKDEAEEETEELTNQVLDEIGVDVASQLSSAPKGRIAVSS 190 Query: 372 SSGDVSLRTLS 340 D + RT++ Sbjct: 191 KKVDTASRTVA 201 >XP_004488205.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Cicer arietinum] Length = 216 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEMLSESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMLSESIDETLDKDEAEEETEELTNQVLDEI 170 >GAU48625.1 hypothetical protein TSUD_405840 [Trifolium subterraneum] Length = 196 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -3 Query: 588 AELDFIEHVWAFLALDRSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 A++D E + + S+ K+ IEM+SESIDETLDKD AEEE+EELTNQV +++ Sbjct: 97 AQMDMTEVIGSICGT--SLSSKSKIEMMSESIDETLDKDEAEEESEELTNQVLDEI 150 >CDP12610.1 unnamed protein product [Coffea canephora] Length = 178 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 92 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 131 >XP_010904643.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Elaeis guineensis] Length = 221 Score = 57.4 bits (137), Expect = 6e-06 Identities = 37/69 (53%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNN----DVPLILSTAQLE*AAVTE 373 +S Q IEM+SE+IDETLDKD AEEETEELTNQV + DV LS+A AV Sbjct: 131 QSAQMDMTIEMMSEAIDETLDKDEAEEETEELTNQVLDEIGVDVASQLSSAPKGRIAVNN 190 Query: 372 SSGDVSLRT 346 D + RT Sbjct: 191 KKVDNATRT 199 >XP_009408560.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2-like [Musa acuminata subsp. malaccensis] Length = 220 Score = 57.0 bits (136), Expect = 8e-06 Identities = 36/71 (50%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNN----DVPLILSTAQLE*AAVTE 373 +S Q IEM+SE+IDETLDKD AEEETEELTNQV + DV LS+A AV Sbjct: 131 QSAQMDMTIEMMSEAIDETLDKDEAEEETEELTNQVLDEIGVDVASQLSSAPKGRIAVNN 190 Query: 372 SSGDVSLRTLS 340 D + R ++ Sbjct: 191 KKVDTASRNVA 201 >KHN45569.1 Vacuolar protein sorting-associated protein 2 like 2 [Glycine soja] Length = 180 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 94 QSAQLDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 133 >KHN41461.1 Vacuolar protein sorting-associated protein 2 like 2 [Glycine soja] Length = 180 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 94 QSAQLDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 133 >KYP37687.1 Vacuolar protein sorting-associated protein 2 isogeny 2 [Cajanus cajan] Length = 182 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 95 QSAQLDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 134 >CBI39020.3 unnamed protein product, partial [Vitis vinifera] Length = 215 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 130 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 169 >XP_018828522.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Juglans regia] Length = 216 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170 >XP_017240997.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Daucus carota subsp. sativus] Length = 216 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170 >XP_012075551.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X1 [Jatropha curcas] XP_012075552.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X1 [Jatropha curcas] XP_012075553.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X2 [Jatropha curcas] XP_012075554.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X2 [Jatropha curcas] KDP34886.1 hypothetical protein JCGZ_09174 [Jatropha curcas] Length = 216 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170 >XP_002277559.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 [Vitis vinifera] Length = 216 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170 >XP_015954900.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X2 [Arachis duranensis] XP_016189216.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2-like isoform X2 [Arachis ipaensis] Length = 217 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170 >XP_015954899.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2 isoform X1 [Arachis duranensis] XP_016189215.1 PREDICTED: vacuolar protein sorting-associated protein 2 homolog 2-like isoform X1 [Arachis ipaensis] Length = 218 Score = 56.6 bits (135), Expect = 1e-05 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 540 RSVQHKALIEMLSESIDETLDKDAAEEETEELTNQVNNDV 421 +S Q IEM+SESIDETLDKD AEEETEELTNQV +++ Sbjct: 131 QSAQMDMTIEMMSESIDETLDKDEAEEETEELTNQVLDEI 170