BLASTX nr result
ID: Papaver32_contig00022606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00022606 (973 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV72540.1 hypothetical protein CFOL_v3_16028 [Cephalotus follic... 60 1e-07 >GAV72540.1 hypothetical protein CFOL_v3_16028 [Cephalotus follicularis] Length = 129 Score = 59.7 bits (143), Expect = 1e-07 Identities = 41/75 (54%), Positives = 42/75 (56%), Gaps = 4/75 (5%) Frame = -1 Query: 313 LPFPTKQFTPL-IAALP--DIPFMLFNSFPMEPTPTMLFPPFSWDDIIIS*MICCTELWG 143 +PFP K PL I LP IP F SFP EPT TM P SW DIIIS I TEL Sbjct: 45 VPFPMKPLPPLRIVLLPVGKIPPTFFTSFPKEPTGTMPPVPLSWLDIIISCKIFWTELGE 104 Query: 142 SLGSTS-GTVDCCME 101 SLGS S V CC E Sbjct: 105 SLGSASLERVGCCSE 119