BLASTX nr result
ID: Papaver32_contig00021281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00021281 (531 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK74822.1 uncharacterized protein A4U43_C03F10490 [Asparagus of... 55 1e-05 >ONK74822.1 uncharacterized protein A4U43_C03F10490 [Asparagus officinalis] Length = 271 Score = 54.7 bits (130), Expect = 1e-05 Identities = 25/57 (43%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -1 Query: 531 GCNCFMLFPRNLAITWAENKQYWNWPSMK-LYDLDLGAALYIFECIIRFRCSFEALY 364 GCNCFMLF R L ITW+EN+ +W W S+K D ++ A + C + FE Y Sbjct: 119 GCNCFMLFARGLLITWSENQNFWQWVSLKETGDEEIEIASLLNVCWLEVHGRFETSY 175