BLASTX nr result
ID: Papaver32_contig00018752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00018752 (593 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY66296.1 hypothetical protein ACMD2_06361 [Ananas comosus] 55 9e-06 >OAY66296.1 hypothetical protein ACMD2_06361 [Ananas comosus] Length = 245 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 365 SHAETAKASVEATEPSREAWMKLCRSFLKGRL 270 SHAE AKAS+EA EP REAW +LC+SFLKG+L Sbjct: 203 SHAEDAKASLEAREPDREAWQRLCKSFLKGKL 234