BLASTX nr result
ID: Papaver32_contig00017437
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00017437 (545 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017982645.1 PREDICTED: eukaryotic translation initiation fact... 55 8e-06 >XP_017982645.1 PREDICTED: eukaryotic translation initiation factor 3 subunit L isoform X1 [Theobroma cacao] Length = 527 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/78 (42%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Frame = -3 Query: 435 MTYKHNIHVVVNK-EIISYADVGFHIEDVVNDILQILLCGEL*QLLISHLVQDIIHYVET 259 +TYKH H V + +IIS ADV F+I+D S L+QD+IH VE+ Sbjct: 455 LTYKHKTHAVDSDGKIISNADVDFYIDDSH-----------------STLLQDMIHVVES 497 Query: 258 KSVKRYGDNFMHQIFKVQ 205 K VKRYGD F+ Q+ K++ Sbjct: 498 KPVKRYGDYFLRQVVKLE 515