BLASTX nr result
ID: Papaver32_contig00013901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013901 (551 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009243660.1 ribosomal protein S4 (mitochondrion) [Cannabis sa... 100 1e-21 YP_005090450.1 ribosomal protein S4 (mitochondrion) [Millettia p... 99 3e-21 AHA47128.1 ribosomal protein S4 (mitochondrion) [Amborella trich... 98 4e-21 YP_005090486.1 ribosomal protein S4 (mitochondrion) [Lotus japon... 98 6e-21 JAT46777.1 Ribosomal protein S4, mitochondrial, partial [Anthuri... 97 8e-21 YP_008802509.1 ribosomal protein S4 (mitochondrion) [Asclepias s... 96 9e-21 BAD83538.2 ribosomal protein S4, partial (mitochondrion) [Nicoti... 97 1e-20 YP_002000578.1 ribosomal protein S4 (mitochondrion) [Oryza sativ... 95 5e-20 YP_003587235.1 ribosomal protein S4 [Citrullus lanatus] ACV96653... 95 8e-20 AKQ51074.1 ribosomal protein subunit S4 (mitochondrion) [Cuscuta... 93 1e-19 YP_009173840.1 ribosomal protein S4 (mitochondrion) [Populus tre... 93 3e-19 ALJ78540.1 ribosomal protein S4, partial (mitochondrion) [Malus ... 92 6e-19 YP_717175.1 ribosomal protein S4 [Brassica napus] BAC98926.1 rib... 92 6e-19 Q31708.2 RecName: Full=Ribosomal protein S4, mitochondrial 92 6e-19 ACH78250.1 ribosomal protein S4 (mitochondrion) [Arabidopsis tha... 92 6e-19 AHC94278.1 ribosomal protein S4, partial (mitochondrion) [Ambore... 91 1e-18 KYP78440.1 hypothetical protein KK1_048244 [Cajanus cajan] 85 1e-18 YP_005090421.1 rps4 gene product (mitochondrion) [Dorcoceras hyg... 91 1e-18 AHF22576.1 ribosomal protein S4, partial (mitochondrion) [Fragar... 91 2e-18 AKE34073.1 ribosomal protein S4, partial (mitochondrion) [Fragar... 91 2e-18 >YP_009243660.1 ribosomal protein S4 (mitochondrion) [Cannabis sativa] ALF04067.1 ribosomal protein S4 (mitochondrion) [Cannabis sativa] AMR97554.1 ribosomal protein S4 (mitochondrion) [Cannabis sativa] ANC49136.1 ribosomal protein S4 (mitochondrion) [Cannabis sativa] Length = 352 Score = 99.8 bits (247), Expect = 1e-21 Identities = 49/80 (61%), Positives = 58/80 (72%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR S I ++LY NST FS SP+++++KR IK+I LPTHY EVN+RTLKAVV Sbjct: 262 NRNLPYPTSSPIGDNSDLYSNSTYFSASPHQFTKKRRIKRIELPTHYSEVNHRTLKAVVS 321 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KDLNLL Sbjct: 322 YGPNIGHIPHDIRLKDLNLL 341 >YP_005090450.1 ribosomal protein S4 (mitochondrion) [Millettia pinnata] YP_005090457.1 ribosomal protein S4 (mitochondrion) [Millettia pinnata] AET62910.1 ribosomal protein S4 (mitochondrion) [Millettia pinnata] AET62917.1 ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 98.6 bits (244), Expect = 3e-21 Identities = 49/80 (61%), Positives = 55/80 (68%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP++++ KR IK+I LPTHY EVNYRTLKAVVF Sbjct: 268 NRYLPTRTRSPIVDYSSLYSNSTYCSSSPHQFTMKRRIKRIELPTHYLEVNYRTLKAVVF 327 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KDLNLL Sbjct: 328 YGPNIGHIPHDIRLKDLNLL 347 >AHA47128.1 ribosomal protein S4 (mitochondrion) [Amborella trichopoda] Length = 354 Score = 98.2 bits (243), Expect = 4e-21 Identities = 48/79 (60%), Positives = 55/79 (69%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR + I LY NST SGSP++++RKR IK+I LPTHY EVNYRTLKAVVF Sbjct: 255 NREISTRTRSPIVNNGNLYSNSTYCSGSPHRFTRKRRIKRIELPTHYLEVNYRTLKAVVF 314 Query: 367 YGPNIDHIPHGISKKDLNL 311 YGP+I HIPH I KD NL Sbjct: 315 YGPDIGHIPHDIRLKDPNL 333 >YP_005090486.1 ribosomal protein S4 (mitochondrion) [Lotus japonicus] AET62946.1 ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 97.8 bits (242), Expect = 6e-21 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = -2 Query: 502 AELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKK 323 + LY NST S SP++++ KR IK+I LPTHY EVNYRTLKAVVFYGPNI HIPH I K Sbjct: 283 SSLYSNSTYCSSSPHQFTMKRRIKRIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLK 342 Query: 322 DLNLL 308 DLNLL Sbjct: 343 DLNLL 347 >JAT46777.1 Ribosomal protein S4, mitochondrial, partial [Anthurium amnicola] JAT60101.1 Ribosomal protein S4, mitochondrial, partial [Anthurium amnicola] Length = 363 Score = 97.4 bits (241), Expect = 8e-21 Identities = 46/65 (70%), Positives = 52/65 (80%) Frame = -2 Query: 502 AELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKK 323 + LY NST SGSP+++ RKR IK+I LPTHY EVN+RT KAVVFYGPNI HIPH I K Sbjct: 288 SSLYSNSTYCSGSPHQFPRKRRIKRIELPTHYLEVNHRTKKAVVFYGPNIGHIPHDIRLK 347 Query: 322 DLNLL 308 DLNLL Sbjct: 348 DLNLL 352 >YP_008802509.1 ribosomal protein S4 (mitochondrion) [Asclepias syriaca] AGZ63043.1 ribosomal protein S4 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 274 Score = 95.9 bits (237), Expect = 9e-21 Identities = 48/80 (60%), Positives = 54/80 (67%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP++++ KR K+I LPTHY EVNYRTLKAVVF Sbjct: 184 NRNIPTRTRSPIVYNSSLYSNSTYCSASPHQFTMKRKRKRIELPTHYLEVNYRTLKAVVF 243 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KDLNLL Sbjct: 244 YGPNIGHIPHDIRLKDLNLL 263 >BAD83538.2 ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 96.7 bits (239), Expect = 1e-20 Identities = 48/80 (60%), Positives = 55/80 (68%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP+++++K IK+I LPTHY EVNYRTLKAVVF Sbjct: 259 NRNIPTRTRSPIVYNSSLYSNSTYCSASPHQFTKKIKIKRIELPTHYLEVNYRTLKAVVF 318 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KDLNLL Sbjct: 319 YGPNIGHIPHDIRLKDLNLL 338 >YP_002000578.1 ribosomal protein S4 (mitochondrion) [Oryza sativa Japonica Group] BAC19883.2 Ribosomal protein S4 (mitochondrion) [Oryza sativa Japonica Group] Length = 352 Score = 95.1 bits (235), Expect = 5e-20 Identities = 51/77 (66%), Positives = 57/77 (74%), Gaps = 3/77 (3%) Frame = -2 Query: 529 NLSKAISKL---AELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGP 359 N +AIS + LY+NST SGSP+ +RK IK+I LPTHY EVNYRTLKAVVFYGP Sbjct: 267 NRKRAISPFVYKSSLYRNSTYCSGSPF--TRKIRIKRIELPTHYLEVNYRTLKAVVFYGP 324 Query: 358 NIDHIPHGISKKDLNLL 308 NI HIPH I KDLNLL Sbjct: 325 NIGHIPHDIRLKDLNLL 341 >YP_003587235.1 ribosomal protein S4 [Citrullus lanatus] ACV96653.1 ribosomal protein S4 (mitochondrion) [Citrullus lanatus] Length = 355 Score = 94.7 bits (234), Expect = 8e-20 Identities = 47/79 (59%), Positives = 53/79 (67%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP++++ K IK+I LPTHY EVNYRTLKAVVF Sbjct: 265 NRNLPTRTRSPIVYNSSLYSNSTYCSASPHQFTMKSKIKRIELPTHYLEVNYRTLKAVVF 324 Query: 367 YGPNIDHIPHGISKKDLNL 311 YGPNI HIPH I KDLNL Sbjct: 325 YGPNIGHIPHDIRLKDLNL 343 >AKQ51074.1 ribosomal protein subunit S4 (mitochondrion) [Cuscuta gronovii] Length = 299 Score = 93.2 bits (230), Expect = 1e-19 Identities = 48/80 (60%), Positives = 53/80 (66%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR + S L LY NST S SP K++RKR IK+I LPTHY EVN+RT KAVV Sbjct: 209 NRNIPTRIRSHNSSLYSLYSNSTYCSASPQKFTRKRRIKRIELPTHYSEVNHRTPKAVVS 268 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KD NLL Sbjct: 269 YGPNIGHIPHDIRLKDPNLL 288 >YP_009173840.1 ribosomal protein S4 (mitochondrion) [Populus tremula] YP_009178738.1 ribosomal protein S4 (mitochondrion) [Populus tremula x Populus alba] YP_009230379.1 ribosomal protein S4 (mitochondrion) [Salix suchowensis] YP_009239012.1 ribosomal protein S4 (mitochondrion) [Salix purpurea] ALH07315.1 ribosomal protein S4 (mitochondrion) [Populus tremula] ALJ49771.1 ribosomal protein S4 (mitochondrion) [Populus tremula x Populus alba] AMF83900.1 ribosomal protein S4 (mitochondrion) [Salix suchowensis] AMO27196.1 ribosomal protein S4 (mitochondrion) [Salix purpurea] Length = 322 Score = 92.8 bits (229), Expect = 3e-19 Identities = 48/80 (60%), Positives = 52/80 (65%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR + I LY NS S SP K++ KR IK+I LPTHY EVNYRTLKAVV Sbjct: 232 NRNLPTRIRSPIVYNYSLYSNSIYCSASPQKWTMKRRIKRIELPTHYVEVNYRTLKAVVS 291 Query: 367 YGPNIDHIPHGISKKDLNLL 308 YGPNI HIPH I KDLNLL Sbjct: 292 YGPNIGHIPHDIRLKDLNLL 311 >ALJ78540.1 ribosomal protein S4, partial (mitochondrion) [Malus hupehensis var. mengshanensis] Length = 359 Score = 92.4 bits (228), Expect = 6e-19 Identities = 46/79 (58%), Positives = 54/79 (68%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY+NST S SP++++ KR IK+I LPTHY EVN+RTLKAVV Sbjct: 269 NRNLPTRTRSPIVYNSSLYRNSTYCSASPHQFTMKRRIKRIELPTHYSEVNHRTLKAVVS 328 Query: 367 YGPNIDHIPHGISKKDLNL 311 YGPNI HIPH I KDLNL Sbjct: 329 YGPNIGHIPHDIRLKDLNL 347 >YP_717175.1 ribosomal protein S4 [Brassica napus] BAC98926.1 ribosomal protein S4 (mitochondrion) [Brassica napus] Length = 362 Score = 92.4 bits (228), Expect = 6e-19 Identities = 45/63 (71%), Positives = 48/63 (76%) Frame = -2 Query: 496 LYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKKDL 317 LY NST SP+K + KR IK+I LPTHY EVNYRT KAVVFYGPNI HIPH I KDL Sbjct: 289 LYSNSTYCFASPHKLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDL 348 Query: 316 NLL 308 NLL Sbjct: 349 NLL 351 >Q31708.2 RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 92.4 bits (228), Expect = 6e-19 Identities = 45/63 (71%), Positives = 48/63 (76%) Frame = -2 Query: 496 LYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKKDL 317 LY NST SP+K + KR IK+I LPTHY EVNYRT KAVVFYGPNI HIPH I KDL Sbjct: 289 LYSNSTYCFASPHKLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDL 348 Query: 316 NLL 308 NLL Sbjct: 349 NLL 351 >ACH78250.1 ribosomal protein S4 (mitochondrion) [Arabidopsis thaliana] Length = 362 Score = 92.4 bits (228), Expect = 6e-19 Identities = 45/63 (71%), Positives = 48/63 (76%) Frame = -2 Query: 496 LYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKKDL 317 LY NST SP+K + KR IK+I LPTHY EVNYRT KAVVFYGPNI HIPH I KDL Sbjct: 289 LYSNSTYCFASPHKLTMKRRIKRIELPTHYLEVNYRTPKAVVFYGPNIGHIPHDIRLKDL 348 Query: 316 NLL 308 NLL Sbjct: 349 NLL 351 >AHC94278.1 ribosomal protein S4, partial (mitochondrion) [Amborella trichopoda] Length = 324 Score = 91.3 bits (225), Expect = 1e-18 Identities = 43/70 (61%), Positives = 50/70 (71%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR + I LY NST SGSP++++RKR IK+I LPTHY EVNYRTLKAVVF Sbjct: 255 NREISTRTRSPIVNNGNLYSNSTYCSGSPHRFTRKRRIKRIELPTHYLEVNYRTLKAVVF 314 Query: 367 YGPNIDHIPH 338 YGP+I HIPH Sbjct: 315 YGPDIGHIPH 324 >KYP78440.1 hypothetical protein KK1_048244 [Cajanus cajan] Length = 76 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = -2 Query: 487 NSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKKDLNL 311 NST S SP+ + RKR IK+I LPTHY EVN+RT KAVVFYGPNI HIPH I KD NL Sbjct: 6 NSTYCSSSPHPFPRKRRIKRIELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLKDPNL 64 >YP_005090421.1 rps4 gene product (mitochondrion) [Dorcoceras hygrometricum] AEK53318.1 ribosomal protein S4 (mitochondrion) [Dorcoceras hygrometricum] Length = 329 Score = 90.9 bits (224), Expect = 1e-18 Identities = 43/65 (66%), Positives = 50/65 (76%) Frame = -2 Query: 502 AELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVFYGPNIDHIPHGISKK 323 + LY NST S SP++++ KR IK+I LPTHY EVN+RT KAVVFYGPNI HIPH I K Sbjct: 254 SSLYSNSTYCSASPHQFTMKRKIKRIELPTHYSEVNHRTPKAVVFYGPNIGHIPHDIRLK 313 Query: 322 DLNLL 308 D NLL Sbjct: 314 DPNLL 318 >AHF22576.1 ribosomal protein S4, partial (mitochondrion) [Fragaria iinumae] AHF22577.1 ribosomal protein S4, partial (mitochondrion) [Fragaria mandshurica] AHF22578.1 ribosomal protein S4, partial (mitochondrion) [Fragaria vesca subsp. bracteata] AHF22579.1 ribosomal protein S4, partial (mitochondrion) [Fragaria chiloensis] AHF22580.1 ribosomal protein S4, partial (mitochondrion) [Fragaria virginiana] AHF22581.1 ribosomal protein S4, partial (mitochondrion) [Fragaria vesca subsp. vesca] AHF22582.1 ribosomal protein S4, partial (mitochondrion) [Fragaria vesca subsp. bracteata] AHF22583.1 ribosomal protein S4, partial (mitochondrion) [Fragaria vesca subsp. bracteata] Length = 346 Score = 90.9 bits (224), Expect = 2e-18 Identities = 46/79 (58%), Positives = 52/79 (65%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP+K++ KR IK+I LPTHY EVN+RT KAVV Sbjct: 256 NRNLPTRTRSPIVDNSSLYSNSTYCSASPHKFTMKRRIKRIELPTHYSEVNHRTPKAVVS 315 Query: 367 YGPNIDHIPHGISKKDLNL 311 YGPNI HIPH I KDLNL Sbjct: 316 YGPNIGHIPHDIRLKDLNL 334 >AKE34073.1 ribosomal protein S4, partial (mitochondrion) [Fragaria chiloensis] Length = 348 Score = 90.9 bits (224), Expect = 2e-18 Identities = 46/79 (58%), Positives = 52/79 (65%) Frame = -2 Query: 547 NRRSTPNLSKAISKLAELYKNSTTFSGSPYKYSRKRSIKKINLPTHYCEVNYRTLKAVVF 368 NR I + LY NST S SP+K++ KR IK+I LPTHY EVN+RT KAVV Sbjct: 258 NRNLPTRTRSPIVDNSSLYSNSTYCSASPHKFTMKRRIKRIELPTHYSEVNHRTPKAVVS 317 Query: 367 YGPNIDHIPHGISKKDLNL 311 YGPNI HIPH I KDLNL Sbjct: 318 YGPNIGHIPHDIRLKDLNL 336