BLASTX nr result
ID: Papaver32_contig00013796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013796 (1104 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006858410.1 PREDICTED: protein transport protein Sec24-like A... 60 3e-06 XP_010246048.1 PREDICTED: protein transport protein Sec24-like A... 60 4e-06 OMO83681.1 Armadillo [Corchorus capsularis] 49 4e-06 OMP04282.1 Zinc finger, Sec23/Sec24-type [Corchorus olitorius] 49 4e-06 >XP_006858410.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Amborella trichopoda] ERN19877.1 hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] Length = 1080 Score = 60.5 bits (145), Expect = 3e-06 Identities = 29/52 (55%), Positives = 35/52 (67%) Frame = +1 Query: 283 PISGELRSKWPLYIYDDGFCFVIWFGSRLFSDLVTKLVGVDFSTLTDLSKVR 438 P+S E LYIYDDGF FVIWFG L +D+V KL+G + S DLSKV+ Sbjct: 954 PLSAESLDPSGLYIYDDGFRFVIWFGKVLSADIVNKLLGPEISAFADLSKVK 1005 >XP_010246048.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] XP_019051890.1 PREDICTED: protein transport protein Sec24-like At3g07100 [Nelumbo nucifera] Length = 998 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +1 Query: 268 FQNVAPISGELRSKWPLYIYDDGFCFVIWFGSRLFSDLVTKLVGVDFSTLTDLSKV 435 F P++ + LYIYDDGF F++WFG L SD+ L+GVD ST DLSKV Sbjct: 867 FSKSLPLTMQSLDSRGLYIYDDGFRFIMWFGKMLSSDIAVNLLGVDLSTFPDLSKV 922 >OMO83681.1 Armadillo [Corchorus capsularis] Length = 1485 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +1 Query: 316 LYIYDDGFCFVIWFGSRLFSDLVTKLVGVDFSTLTDLSKV 435 LYIYDDGF FVIWFG L D+ L+G DF+ +LSKV Sbjct: 926 LYIYDDGFRFVIWFGRMLSPDIAKNLLGADFA--AELSKV 963 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 227 LWQASANSDGSRNHFKMLPLSVESLDPSGLSIY 325 L + SA D +N K LPL +SLD GL IY Sbjct: 897 LLKPSAQGDDLKNIMKRLPLVADSLDSRGLYIY 929 >OMP04282.1 Zinc finger, Sec23/Sec24-type [Corchorus olitorius] Length = 1003 Score = 49.3 bits (116), Expect(2) = 4e-06 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +1 Query: 316 LYIYDDGFCFVIWFGSRLFSDLVTKLVGVDFSTLTDLSKV 435 LYIYDDGF FVIWFG L D+ L+G DF+ +LSKV Sbjct: 890 LYIYDDGFRFVIWFGRMLSPDIAKNLLGADFA--AELSKV 927 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 227 LWQASANSDGSRNHFKMLPLSVESLDPSGLSIY 325 L + SA D +N K LPL +SLD GL IY Sbjct: 861 LLKPSAQGDDLKNIMKRLPLVADSLDSRGLYIY 893