BLASTX nr result
ID: Papaver32_contig00013786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013786 (412 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012072737.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 67 2e-10 XP_004309829.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 67 2e-10 XP_006372771.1 hypothetical protein POPTR_0017s04900g [Populus t... 67 4e-10 XP_011043597.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 67 4e-10 XP_011043596.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 67 4e-10 EMS45067.1 Ribosome biogenesis protein BMS1-like protein [Tritic... 66 5e-10 ONH90683.1 hypothetical protein PRUPE_8G069100 [Prunus persica] 66 7e-10 XP_006651345.1 PREDICTED: ribosome biogenesis protein bms1 [Oryz... 66 7e-10 XP_020147545.1 ribosome biogenesis protein BMS1 homolog [Aegilop... 66 7e-10 ONH90682.1 hypothetical protein PRUPE_8G069100 [Prunus persica] 66 7e-10 XP_009411567.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 66 7e-10 XP_016650854.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 66 7e-10 XP_009411565.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 66 7e-10 ONI35658.1 hypothetical protein PRUPE_1G548200 [Prunus persica] 66 7e-10 XP_008219075.1 PREDICTED: ribosome biogenesis protein BMS1 homol... 66 7e-10 XP_007227083.1 hypothetical protein PRUPE_ppa000405mg [Prunus pe... 66 7e-10 XP_007199685.1 hypothetical protein PRUPE_ppa000398mg [Prunus pe... 66 7e-10 EMT17008.1 Ribosome biogenesis BMS1-like protein [Aegilops tausc... 66 7e-10 EEE59004.1 hypothetical protein OsJ_10724 [Oryza sativa Japonica... 65 1e-09 EEC75190.1 hypothetical protein OsI_11428 [Oryza sativa Indica G... 65 1e-09 >XP_012072737.1 PREDICTED: ribosome biogenesis protein BMS1 homolog [Jatropha curcas] KDP37695.1 hypothetical protein JCGZ_06352 [Jatropha curcas] Length = 1208 Score = 67.4 bits (163), Expect = 2e-10 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D + E PPYV+VVHGPPKVGKSLLIKCLV +YTK N + GP+ I++G Sbjct: 73 HVPVIDRSYGEP-PPYVVVVHGPPKVGKSLLIKCLVKHYTKH-NLPEVQGPMTIVSG 127 >XP_004309829.1 PREDICTED: ribosome biogenesis protein BMS1 homolog [Fragaria vesca subsp. vesca] Length = 1211 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTK-SANHSNMAGPIRILAG 411 H P++D + + PP+V++VHGPPKVGKSLLIKCLV +YTK +++ GPI I++G Sbjct: 63 HLPTIDRSYGLDPPPFVVLVHGPPKVGKSLLIKCLVKHYTKHDLPSASVQGPITIVSG 120 >XP_006372771.1 hypothetical protein POPTR_0017s04900g [Populus trichocarpa] ERP50568.1 hypothetical protein POPTR_0017s04900g [Populus trichocarpa] Length = 1181 Score = 66.6 bits (161), Expect = 4e-10 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 259 PTIEE---ERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 PTIE E PP+V+VVHGPP+VGKSLLIKCLV +YTK N + GPI I++G Sbjct: 72 PTIERNYGEPPPFVVVVHGPPQVGKSLLIKCLVKHYTKH-NIQEVRGPITIVSG 124 >XP_011043597.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X2 [Populus euphratica] XP_011043598.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X3 [Populus euphratica] Length = 1195 Score = 66.6 bits (161), Expect = 4e-10 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 259 PTIEE---ERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 PTIE E PP+V+VVHGPP+VGKSLLIKCLV +YTK N + GPI I++G Sbjct: 72 PTIERNYGEPPPFVVVVHGPPQVGKSLLIKCLVKHYTKH-NIQEVRGPITIVSG 124 >XP_011043596.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X1 [Populus euphratica] Length = 1206 Score = 66.6 bits (161), Expect = 4e-10 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 259 PTIEE---ERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 PTIE E PP+V+VVHGPP+VGKSLLIKCLV +YTK N + GPI I++G Sbjct: 72 PTIERNYGEPPPFVVVVHGPPQVGKSLLIKCLVKHYTKH-NIQEVRGPITIVSG 124 >EMS45067.1 Ribosome biogenesis protein BMS1-like protein [Triticum urartu] Length = 1200 Score = 66.2 bits (160), Expect = 5e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S++ GPI +++G Sbjct: 70 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSDVCGPITVVSG 124 >ONH90683.1 hypothetical protein PRUPE_8G069100 [Prunus persica] Length = 919 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 67 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 121 >XP_006651345.1 PREDICTED: ribosome biogenesis protein bms1 [Oryza brachyantha] Length = 1175 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S + GPI +++G Sbjct: 72 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSEVCGPITVVSG 126 >XP_020147545.1 ribosome biogenesis protein BMS1 homolog [Aegilops tauschii subsp. tauschii] Length = 1196 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S++ GPI +++G Sbjct: 71 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSDVRGPITVVSG 125 >ONH90682.1 hypothetical protein PRUPE_8G069100 [Prunus persica] Length = 1200 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 67 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 121 >XP_009411567.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X2 [Musa acuminata subsp. malaccensis] Length = 1200 Score = 65.9 bits (159), Expect = 7e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E PP+++VV GPPKVGKSLLIKCLV +YTK N S + GPI +++G Sbjct: 67 HVPTIDRSTGE-LPPFIVVVQGPPKVGKSLLIKCLVKHYTKH-NLSEVRGPITVVSG 121 >XP_016650854.1 PREDICTED: ribosome biogenesis protein BMS1 homolog [Prunus mume] Length = 1201 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 67 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 121 >XP_009411565.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X1 [Musa acuminata subsp. malaccensis] XP_009411566.1 PREDICTED: ribosome biogenesis protein BMS1 homolog isoform X1 [Musa acuminata subsp. malaccensis] Length = 1202 Score = 65.9 bits (159), Expect = 7e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E PP+++VV GPPKVGKSLLIKCLV +YTK N S + GPI +++G Sbjct: 67 HVPTIDRSTGE-LPPFIVVVQGPPKVGKSLLIKCLVKHYTKH-NLSEVRGPITVVSG 121 >ONI35658.1 hypothetical protein PRUPE_1G548200 [Prunus persica] Length = 1203 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 68 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 122 >XP_008219075.1 PREDICTED: ribosome biogenesis protein BMS1 homolog [Prunus mume] Length = 1203 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 68 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 122 >XP_007227083.1 hypothetical protein PRUPE_ppa000405mg [Prunus persica] Length = 1204 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 68 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 122 >XP_007199685.1 hypothetical protein PRUPE_ppa000398mg [Prunus persica] Length = 1208 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P++D + E+ PPYV++VHGPPKVGKSLLIK LV +YTK N + GPI I++G Sbjct: 67 HVPTIDRSYGEQ-PPYVVLVHGPPKVGKSLLIKSLVKHYTKH-NLPEVRGPITIVSG 121 >EMT17008.1 Ribosome biogenesis BMS1-like protein [Aegilops tauschii] Length = 1287 Score = 65.9 bits (159), Expect = 7e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S++ GPI +++G Sbjct: 112 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSDVRGPITVVSG 166 >EEE59004.1 hypothetical protein OsJ_10724 [Oryza sativa Japonica Group] Length = 1130 Score = 65.5 bits (158), Expect = 1e-09 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S + GPI +++G Sbjct: 73 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSEVRGPITVVSG 127 >EEC75190.1 hypothetical protein OsI_11428 [Oryza sativa Indica Group] Length = 1130 Score = 65.5 bits (158), Expect = 1e-09 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 241 HPPSVDPTIEEERPPYVIVVHGPPKVGKSLLIKCLVNYYTKSANHSNMAGPIRILAG 411 H P +D +I E PP+V+VV GPP+VGKSLLIKCLV +YTK N S + GPI +++G Sbjct: 73 HVPIMDRSIGEP-PPFVVVVQGPPQVGKSLLIKCLVKHYTKQ-NLSEVRGPITVVSG 127