BLASTX nr result
ID: Papaver32_contig00013781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013781 (1001 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012074706.1 PREDICTED: SNF1-related protein kinase regulatory... 59 4e-10 CAN73518.1 hypothetical protein VITISV_033732 [Vitis vinifera] 61 5e-10 XP_008778688.1 PREDICTED: uncharacterized protein LOC103698451 [... 56 5e-10 JAT57209.1 SNF1-related protein kinase regulatory subunit beta-1... 57 5e-10 XP_002270683.1 PREDICTED: SNF1-related protein kinase regulatory... 61 5e-10 XP_016688633.1 PREDICTED: SNF1-related protein kinase regulatory... 62 8e-10 OAY21206.1 hypothetical protein MANES_S108600 [Manihot esculenta] 60 8e-10 XP_016750488.1 PREDICTED: SNF1-related protein kinase regulatory... 61 1e-09 XP_017602989.1 PREDICTED: SNF1-related protein kinase regulatory... 61 1e-09 XP_002515602.2 PREDICTED: SNF1-related protein kinase regulatory... 60 1e-09 XP_006446402.1 hypothetical protein CICLE_v10016186mg [Citrus cl... 60 2e-09 KDO66341.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] 60 2e-09 XP_006446401.1 hypothetical protein CICLE_v10016186mg [Citrus cl... 60 2e-09 KDO66342.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] 60 2e-09 XP_006470426.1 PREDICTED: SNF1-related protein kinase regulatory... 60 2e-09 KDO66343.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] 60 2e-09 XP_012444662.1 PREDICTED: SNF1-related protein kinase regulatory... 60 3e-09 KJB55988.1 hypothetical protein B456_009G106200 [Gossypium raimo... 60 3e-09 OMO67511.1 hypothetical protein CCACVL1_20488 [Corchorus capsula... 60 4e-09 OMO91472.1 hypothetical protein COLO4_18344 [Corchorus olitorius] 60 4e-09 >XP_012074706.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1 [Jatropha curcas] KDP46000.1 hypothetical protein JCGZ_14907 [Jatropha curcas] Length = 294 Score = 58.9 bits (141), Expect(2) = 4e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKD+SILLVLPSGIY YKFIVDGEWRYI Sbjct: 142 GKDYSILLVLPSGIYHYKFIVDGEWRYI 169 Score = 34.7 bits (78), Expect(2) = 4e-10 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIP+LPC+ADEMG + NL Sbjct: 168 YIPELPCVADEMGRVCNL 185 >CAN73518.1 hypothetical protein VITISV_033732 [Vitis vinifera] Length = 447 Score = 60.8 bits (146), Expect(2) = 5e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSILLVLPSG+Y YKFIVDGEWRYI Sbjct: 185 GKDHSILLVLPSGVYHYKFIVDGEWRYI 212 Score = 32.3 bits (72), Expect(2) = 5e-10 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP IADEMG + NL Sbjct: 211 YIPDLPFIADEMGRVCNL 228 >XP_008778688.1 PREDICTED: uncharacterized protein LOC103698451 [Phoenix dactylifera] Length = 442 Score = 55.8 bits (133), Expect(2) = 5e-10 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 751 YGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + G DHSILLVLPSG+YQYKFIVDGE RYI Sbjct: 289 WSGMDHSILLVLPSGVYQYKFIVDGERRYI 318 Score = 37.4 bits (85), Expect(2) = 5e-10 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANLFIWRLAISAIPKSI 934 YIPDLPCIADEMG I NL + P+S+ Sbjct: 317 YIPDLPCIADEMGQITNLLDVHDYVPENPESV 348 >JAT57209.1 SNF1-related protein kinase regulatory subunit beta-1, partial [Anthurium amnicola] Length = 354 Score = 57.0 bits (136), Expect(2) = 5e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSILLVLPSGIYQYKFIVDGE +YI Sbjct: 204 GKDHSILLVLPSGIYQYKFIVDGEGKYI 231 Score = 36.2 bits (82), Expect(2) = 5e-10 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 833 GIYIPDLPCIADEMG*IANL 892 G YIPDLPC+ADEMG + N+ Sbjct: 228 GKYIPDLPCVADEMGHVVNV 247 >XP_002270683.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1 [Vitis vinifera] CBI24331.3 unnamed protein product, partial [Vitis vinifera] Length = 286 Score = 60.8 bits (146), Expect(2) = 5e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSILLVLPSG+Y YKFIVDGEWRYI Sbjct: 134 GKDHSILLVLPSGVYHYKFIVDGEWRYI 161 Score = 32.3 bits (72), Expect(2) = 5e-10 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP IADEMG + NL Sbjct: 160 YIPDLPFIADEMGRVCNL 177 >XP_016688633.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium hirsutum] XP_016688634.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium hirsutum] Length = 284 Score = 61.6 bits (148), Expect(2) = 8e-10 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +1 Query: 730 RNLPMFYYGGKDHSILLVLPSGIYQYKFIVDGEWRY 837 R+ M GKDHSILLVLPSGIY YKFIVDGEWRY Sbjct: 123 RSRKMLQRSGKDHSILLVLPSGIYHYKFIVDGEWRY 158 Score = 30.8 bits (68), Expect(2) = 8e-10 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 Y PDLP IADEMG I NL Sbjct: 158 YTPDLPFIADEMGRICNL 175 >OAY21206.1 hypothetical protein MANES_S108600 [Manihot esculenta] Length = 250 Score = 60.5 bits (145), Expect(2) = 8e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSIL+VLPSGIY YKFIVDGEWRYI Sbjct: 141 GKDHSILMVLPSGIYHYKFIVDGEWRYI 168 Score = 32.0 bits (71), Expect(2) = 8e-10 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADEMG + NL Sbjct: 167 YIPDLPFVADEMGCVCNL 184 >XP_016750488.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium hirsutum] Length = 284 Score = 61.2 bits (147), Expect(2) = 1e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 730 RNLPMFYYGGKDHSILLVLPSGIYQYKFIVDGEWRY 837 R+ M GKDHSILLVLPSG+Y YKFIVDGEWRY Sbjct: 123 RSRKMLQRSGKDHSILLVLPSGVYHYKFIVDGEWRY 158 Score = 30.8 bits (68), Expect(2) = 1e-09 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 Y PDLP IADEMG I NL Sbjct: 158 YTPDLPFIADEMGHICNL 175 >XP_017602989.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium arboreum] KHG29234.1 SNF1-related protein kinase regulatory subunit beta-1 [Gossypium arboreum] Length = 284 Score = 61.2 bits (147), Expect(2) = 1e-09 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 730 RNLPMFYYGGKDHSILLVLPSGIYQYKFIVDGEWRY 837 R+ M GKDHSILLVLPSG+Y YKFIVDGEWRY Sbjct: 123 RSRKMLQRSGKDHSILLVLPSGVYHYKFIVDGEWRY 158 Score = 30.8 bits (68), Expect(2) = 1e-09 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 Y PDLP IADEMG I NL Sbjct: 158 YTPDLPFIADEMGRICNL 175 >XP_002515602.2 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1, partial [Ricinus communis] Length = 166 Score = 59.7 bits (143), Expect(2) = 1e-09 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y Y FIVDGEWRYI Sbjct: 9 LLHRSGKDHSILLVLPSGVYHYNFIVDGEWRYI 41 Score = 32.3 bits (72), Expect(2) = 1e-09 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADEMG I NL Sbjct: 40 YIPDLPFVADEMGRICNL 57 >XP_006446402.1 hypothetical protein CICLE_v10016186mg [Citrus clementina] ESR59642.1 hypothetical protein CICLE_v10016186mg [Citrus clementina] Length = 281 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 124 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 156 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 155 YIPDLPFVADELGGVCNL 172 >KDO66341.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] Length = 279 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 122 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 154 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 153 YIPDLPFVADELGGVCNL 170 >XP_006446401.1 hypothetical protein CICLE_v10016186mg [Citrus clementina] ESR59641.1 hypothetical protein CICLE_v10016186mg [Citrus clementina] Length = 277 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 120 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 152 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 151 YIPDLPFVADELGGVCNL 168 >KDO66342.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] Length = 275 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 118 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 150 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 149 YIPDLPFVADELGGVCNL 166 >XP_006470426.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1 [Citrus sinensis] Length = 273 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 116 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 148 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 147 YIPDLPFVADELGGVCNL 164 >KDO66343.1 hypothetical protein CISIN_1g0236641mg [Citrus sinensis] Length = 202 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 742 MFYYGGKDHSILLVLPSGIYQYKFIVDGEWRYI 840 + + GKDHSILLVLPSG+Y YKFIVDG+WRYI Sbjct: 45 ILHRSGKDHSILLVLPSGVYHYKFIVDGDWRYI 77 Score = 30.8 bits (68), Expect(2) = 2e-09 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE+G + NL Sbjct: 76 YIPDLPFVADELGGVCNL 93 >XP_012444662.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium raimondii] XP_012444664.1 PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Gossypium raimondii] KJB55986.1 hypothetical protein B456_009G106200 [Gossypium raimondii] KJB55987.1 hypothetical protein B456_009G106200 [Gossypium raimondii] Length = 284 Score = 59.7 bits (143), Expect(2) = 3e-09 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +1 Query: 730 RNLPMFYYGGKDHSILLVLPSGIYQYKFIVDGEWRY 837 R+ M GKDHSILLVLP GIY YKFIVDGEWRY Sbjct: 123 RSRKMLQRSGKDHSILLVLPPGIYHYKFIVDGEWRY 158 Score = 30.8 bits (68), Expect(2) = 3e-09 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 Y PDLP IADEMG I NL Sbjct: 158 YTPDLPFIADEMGRICNL 175 >KJB55988.1 hypothetical protein B456_009G106200 [Gossypium raimondii] Length = 223 Score = 59.7 bits (143), Expect(2) = 3e-09 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +1 Query: 730 RNLPMFYYGGKDHSILLVLPSGIYQYKFIVDGEWRY 837 R+ M GKDHSILLVLP GIY YKFIVDGEWRY Sbjct: 62 RSRKMLQRSGKDHSILLVLPPGIYHYKFIVDGEWRY 97 Score = 30.8 bits (68), Expect(2) = 3e-09 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 Y PDLP IADEMG I NL Sbjct: 97 YTPDLPFIADEMGRICNL 114 >OMO67511.1 hypothetical protein CCACVL1_20488 [Corchorus capsularis] Length = 286 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSILLVLPSG+Y YKFIVDGEWRYI Sbjct: 134 GKDHSILLVLPSGLYHYKFIVDGEWRYI 161 Score = 29.6 bits (65), Expect(2) = 4e-09 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE G + NL Sbjct: 160 YIPDLPFVADETGHVCNL 177 >OMO91472.1 hypothetical protein COLO4_18344 [Corchorus olitorius] Length = 255 Score = 60.5 bits (145), Expect(2) = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 757 GKDHSILLVLPSGIYQYKFIVDGEWRYI 840 GKDHSILLVLPSG+Y YKFIVDGEWRYI Sbjct: 134 GKDHSILLVLPSGLYHYKFIVDGEWRYI 161 Score = 29.6 bits (65), Expect(2) = 4e-09 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 839 YIPDLPCIADEMG*IANL 892 YIPDLP +ADE G + NL Sbjct: 160 YIPDLPFVADETGHVCNL 177