BLASTX nr result
ID: Papaver32_contig00013677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013677 (1520 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010244481.1 PREDICTED: eukaryotic translation initiation fact... 68 3e-14 XP_010263557.1 PREDICTED: uncharacterized protein LOC104601792 i... 64 4e-14 XP_010263559.1 PREDICTED: uncharacterized protein LOC104601792 i... 64 4e-14 XP_009413702.1 PREDICTED: eukaryotic translation initiation fact... 69 7e-14 XP_010275672.1 PREDICTED: eukaryotic translation initiation fact... 67 7e-14 XP_017642356.1 PREDICTED: eukaryotic translation initiation fact... 65 2e-13 XP_016733811.1 PREDICTED: eukaryotic translation initiation fact... 65 2e-13 XP_016724297.1 PREDICTED: eukaryotic translation initiation fact... 65 2e-13 XP_012453147.1 PREDICTED: eukaryotic translation initiation fact... 65 2e-13 KHF98089.1 Eukaryotic translation initiation factor 2 subunit 3 ... 65 2e-13 XP_016733808.1 PREDICTED: eukaryotic translation initiation fact... 65 2e-13 KJB12636.1 hypothetical protein B456_002G028500 [Gossypium raimo... 65 2e-13 XP_003596199.1 eukaryotic translation initiation factor 2 EIF2-g... 65 3e-13 XP_019433374.1 PREDICTED: eukaryotic translation initiation fact... 65 3e-13 XP_019456483.1 PREDICTED: eukaryotic translation initiation fact... 65 3e-13 KYP49133.1 Eukaryotic translation initiation factor 2 subunit 3 ... 65 3e-13 XP_013464305.1 eukaryotic translation initiation factor 2 EIF2-g... 65 3e-13 XP_007150547.1 hypothetical protein PHAVU_005G161600g [Phaseolus... 65 3e-13 XP_007150546.1 hypothetical protein PHAVU_005G161500g [Phaseolus... 65 3e-13 XP_004488828.1 PREDICTED: eukaryotic translation initiation fact... 65 3e-13 >XP_010244481.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Nelumbo nucifera] Length = 464 Score = 67.8 bits (164), Expect(2) = 3e-14 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPGSEVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGSEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 3e-14 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_010263557.1 PREDICTED: uncharacterized protein LOC104601792 isoform X1 [Nelumbo nucifera] XP_010263558.1 PREDICTED: uncharacterized protein LOC104601792 isoform X1 [Nelumbo nucifera] Length = 2507 Score = 63.5 bits (153), Expect(2) = 4e-14 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 4/77 (5%) Frame = -1 Query: 1493 SQEFRSGRKNACYGPGGRQNGDALC----GREVGYNARDRYSSGQIYRYRGDFFPKSLVR 1326 +Q+ R GRK+ YG GGRQN + GR N RDR+ G RYRGD F + + Sbjct: 448 TQDLRFGRKDLAYGQGGRQNFSHIAVPFSGRGGEQNVRDRHGGGISNRYRGDMFQTNSMP 507 Query: 1325 KTSFSLGSRGPAVDNPV 1275 K SFSLG +G V++P+ Sbjct: 508 KNSFSLGVKGLPVNDPI 524 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -3 Query: 1239 KPYTEDCFLKDIVNGPGFDGRVPFTGGHVWVFKKK 1135 KPY ED FLKD GPGFD R PF+ V VF++K Sbjct: 539 KPYQEDPFLKDFGIGPGFDVRDPFSSSLVGVFRRK 573 >XP_010263559.1 PREDICTED: uncharacterized protein LOC104601792 isoform X2 [Nelumbo nucifera] Length = 2504 Score = 63.5 bits (153), Expect(2) = 4e-14 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 4/77 (5%) Frame = -1 Query: 1493 SQEFRSGRKNACYGPGGRQNGDALC----GREVGYNARDRYSSGQIYRYRGDFFPKSLVR 1326 +Q+ R GRK+ YG GGRQN + GR N RDR+ G RYRGD F + + Sbjct: 448 TQDLRFGRKDLAYGQGGRQNFSHIAVPFSGRGGEQNVRDRHGGGISNRYRGDMFQTNSMP 507 Query: 1325 KTSFSLGSRGPAVDNPV 1275 K SFSLG +G V++P+ Sbjct: 508 KNSFSLGVKGLPVNDPI 524 Score = 44.3 bits (103), Expect(2) = 4e-14 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = -3 Query: 1239 KPYTEDCFLKDIVNGPGFDGRVPFTGGHVWVFKKK 1135 KPY ED FLKD GPGFD R PF+ V VF++K Sbjct: 539 KPYQEDPFLKDFGIGPGFDVRDPFSSSLVGVFRRK 573 >XP_009413702.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Musa acuminata subsp. malaccensis] Length = 464 Score = 68.6 bits (166), Expect(2) = 7e-14 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 LV++IPIPERNFISPPNM VI SFDVNKPGSEVD++K Sbjct: 231 LVKKIPIPERNFISPPNMIVIRSFDVNKPGSEVDEIK 267 Score = 38.5 bits (88), Expect(2) = 7e-14 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G I+ Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIK 302 >XP_010275672.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Nelumbo nucifera] XP_010275681.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Nelumbo nucifera] Length = 464 Score = 67.4 bits (163), Expect(2) = 7e-14 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNF+SPPNM VI SFDVNKPGSEVD++K Sbjct: 231 IVKKIPIPERNFVSPPNMIVIRSFDVNKPGSEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 7e-14 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302 >XP_017642356.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium arboreum] XP_017642357.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium arboreum] XP_017642358.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium arboreum] Length = 464 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_016733811.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X2 [Gossypium hirsutum] Length = 464 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_016724297.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium hirsutum] XP_016724298.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium hirsutum] Length = 464 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_012453147.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium raimondii] XP_012453151.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like [Gossypium raimondii] KJB12635.1 hypothetical protein B456_002G028500 [Gossypium raimondii] KJB12637.1 hypothetical protein B456_002G028500 [Gossypium raimondii] Length = 464 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >KHF98089.1 Eukaryotic translation initiation factor 2 subunit 3 [Gossypium arboreum] Length = 464 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_016733808.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X1 [Gossypium hirsutum] XP_016733809.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X1 [Gossypium hirsutum] XP_016733810.1 PREDICTED: eukaryotic translation initiation factor 2 subunit 3-like isoform X1 [Gossypium hirsutum] Length = 374 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 141 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 177 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 190 LKVNQFIEVRPGIVVKDENGNIK 212 >KJB12636.1 hypothetical protein B456_002G028500 [Gossypium raimondii] Length = 374 Score = 65.5 bits (158), Expect(2) = 2e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 141 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 177 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 190 LKVNQFIEVRPGIVVKDENGNIK 212 >XP_003596199.1 eukaryotic translation initiation factor 2 EIF2-gamma-II [Medicago truncatula] AES66450.1 eukaryotic translation initiation factor 2 EIF2-gamma-II [Medicago truncatula] Length = 643 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 408 IVKKIPIPERNFISPPNMIVIRSFDVNKPGYEVDEIK 444 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 457 LKVNQFIEVRPGIVVKDESGNIR 479 >XP_019433374.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Lupinus angustifolius] OIW21593.1 hypothetical protein TanjilG_06439 [Lupinus angustifolius] Length = 471 Score = 64.7 bits (156), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD +K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDDIK 267 Score = 40.4 bits (93), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >XP_019456483.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Lupinus angustifolius] OIW04778.1 hypothetical protein TanjilG_06367 [Lupinus angustifolius] Length = 471 Score = 64.7 bits (156), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD +K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDDIK 267 Score = 40.4 bits (93), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DENG I+ Sbjct: 280 LKVNQFIEVRPGIVVKDENGNIK 302 >KYP49133.1 Eukaryotic translation initiation factor 2 subunit 3 [Cajanus cajan] Length = 466 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302 >XP_013464305.1 eukaryotic translation initiation factor 2 EIF2-gamma-II [Medicago truncatula] KEH38340.1 eukaryotic translation initiation factor 2 EIF2-gamma-II [Medicago truncatula] Length = 466 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGYEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302 >XP_007150547.1 hypothetical protein PHAVU_005G161600g [Phaseolus vulgaris] ESW22541.1 hypothetical protein PHAVU_005G161600g [Phaseolus vulgaris] Length = 466 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302 >XP_007150546.1 hypothetical protein PHAVU_005G161500g [Phaseolus vulgaris] ESW22540.1 hypothetical protein PHAVU_005G161500g [Phaseolus vulgaris] Length = 466 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGFEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302 >XP_004488828.1 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Cicer arietinum] XP_004488827.2 PREDICTED: eukaryotic translation initiation factor 2 subunit gamma-like [Cicer arietinum] Length = 466 Score = 65.5 bits (158), Expect(2) = 3e-13 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 387 LVRRIPIPERNFISPPNMSVIGSFDVNKPGSEVDQVK 497 +V++IPIPERNFISPPNM VI SFDVNKPG EVD++K Sbjct: 231 IVKKIPIPERNFISPPNMIVIRSFDVNKPGYEVDEIK 267 Score = 39.7 bits (91), Expect(2) = 3e-13 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +2 Query: 533 LKVTQFIEVRPGIVCRDENGTIR 601 LKV QFIEVRPGIV +DE+G IR Sbjct: 280 LKVNQFIEVRPGIVVKDESGNIR 302