BLASTX nr result
ID: Papaver32_contig00013606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00013606 (1423 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444032.1 hypothetical protein CICLE_v10018932mg [Citrus cl... 99 3e-18 XP_003632339.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 6e-18 CBI28722.3 unnamed protein product, partial [Vitis vinifera] 98 8e-18 KNA23768.1 hypothetical protein SOVF_022320 [Spinacia oleracea] 97 1e-17 XP_012473539.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 1e-17 XP_007050539.2 PREDICTED: pentatricopeptide repeat-containing pr... 97 1e-17 XP_002306785.2 hypothetical protein POPTR_0005s23410g [Populus t... 96 2e-17 XP_010269003.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_012081319.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_012081318.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_019266394.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_017624011.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_012081315.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_015893076.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-17 XP_011084681.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-17 EOX94696.1 Pentatricopeptide repeat (PPR) superfamily protein [T... 95 4e-17 XP_012084287.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-17 XP_018833062.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-17 XP_004299875.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-17 XP_012084286.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 5e-17 >XP_006444032.1 hypothetical protein CICLE_v10018932mg [Citrus clementina] XP_006479684.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Citrus sinensis] XP_006479685.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial isoform X1 [Citrus sinensis] ESR57272.1 hypothetical protein CICLE_v10018932mg [Citrus clementina] KDO68671.1 hypothetical protein CISIN_1g003946mg [Citrus sinensis] Length = 784 Score = 98.6 bits (244), Expect = 3e-18 Identities = 49/66 (74%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF RANEVV MME GKMFIDKYKYRTLFL Y KTL+K KTP F +EA +K+R+AAL F Sbjct: 719 GFFARANEVVAMMEEGKMFIDKYKYRTLFLKYHKTLYKG-KTPKFQTEAQLKKREAALGF 777 Query: 1241 KEWLGL 1224 K+WLGL Sbjct: 778 KKWLGL 783 >XP_003632339.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] XP_010651991.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] XP_019076395.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] Length = 784 Score = 97.8 bits (242), Expect = 6e-18 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVVEMME GKMFIDKYKYRTLFL Y KTL+K+ K P +EA +RRDAAL F Sbjct: 719 GFFVRANEVVEMMERGKMFIDKYKYRTLFLKYHKTLYKS-KPPKVQTEAQFRRRDAALTF 777 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 778 KKWVGL 783 >CBI28722.3 unnamed protein product, partial [Vitis vinifera] Length = 1361 Score = 97.8 bits (242), Expect = 8e-18 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVVEMME GKMFIDKYKYRTLFL Y KTL+K+ K P +EA +RRDAAL F Sbjct: 1296 GFFVRANEVVEMMERGKMFIDKYKYRTLFLKYHKTLYKS-KPPKVQTEAQFRRRDAALTF 1354 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 1355 KKWVGL 1360 >KNA23768.1 hypothetical protein SOVF_022320 [Spinacia oleracea] Length = 772 Score = 97.1 bits (240), Expect = 1e-17 Identities = 47/66 (71%), Positives = 53/66 (80%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF RANEVVEMME G MFIDKY+YRTLFL Y KTL+K KTP F +EA K+RDA L F Sbjct: 707 GFFFRANEVVEMMEKGNMFIDKYRYRTLFLKYHKTLYKG-KTPKFETEAQSKKRDATLAF 765 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 766 KKWVGL 771 >XP_012473539.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium raimondii] KJB22591.1 hypothetical protein B456_004G055800 [Gossypium raimondii] Length = 778 Score = 96.7 bits (239), Expect = 1e-17 Identities = 45/66 (68%), Positives = 56/66 (84%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV+MME G MFIDKYKYRTL+L Y KTL+K KTP F +E+ +K+R+AAL F Sbjct: 713 GFFIRANEVVDMMEKGNMFIDKYKYRTLYLKYHKTLYKG-KTPKFQTESQLKKREAALSF 771 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 772 KKWIGL 777 >XP_007050539.2 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Theobroma cacao] Length = 780 Score = 96.7 bits (239), Expect = 1e-17 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV+MME G MFIDKYKYRTLFL Y KTL+K K P F +EA +K+R+AAL F Sbjct: 715 GFFVRANEVVDMMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLKKREAALTF 773 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 774 KKWVGL 779 >XP_002306785.2 hypothetical protein POPTR_0005s23410g [Populus trichocarpa] EEE93781.2 hypothetical protein POPTR_0005s23410g [Populus trichocarpa] Length = 787 Score = 96.3 bits (238), Expect = 2e-17 Identities = 47/66 (71%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF RANEVV+MME GKMFIDKYKYRTL+L Y KTL+K KTP +E+ VK+R+AAL F Sbjct: 722 GFFSRANEVVDMMEKGKMFIDKYKYRTLYLKYHKTLYKG-KTPKIQTESLVKKREAALTF 780 Query: 1241 KEWLGL 1224 K+WLGL Sbjct: 781 KKWLGL 786 >XP_010269003.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nelumbo nucifera] XP_010269004.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nelumbo nucifera] Length = 789 Score = 95.9 bits (237), Expect = 3e-17 Identities = 47/66 (71%), Positives = 54/66 (81%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFFLRANEVVEMME +FIDKYKYRTLFL Y KTL+K KK P F +EA +RR+AAL F Sbjct: 724 GFFLRANEVVEMMEVENLFIDKYKYRTLFLKYHKTLYK-KKAPKFQTEAQCQRREAALAF 782 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 783 KKWVGL 788 >XP_012081319.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X3 [Jatropha curcas] Length = 683 Score = 95.5 bits (236), Expect = 3e-17 Identities = 44/66 (66%), Positives = 54/66 (81%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV+MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L F Sbjct: 619 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSF 677 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 678 KKWVGL 683 >XP_012081318.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] Length = 689 Score = 95.5 bits (236), Expect = 3e-17 Identities = 44/66 (66%), Positives = 54/66 (81%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV+MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L F Sbjct: 625 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSF 683 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 684 KKWVGL 689 >XP_019266394.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266402.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266411.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266417.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266420.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266425.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266431.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266436.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266445.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266452.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] XP_019266458.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana attenuata] OIT05530.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 776 Score = 95.5 bits (236), Expect = 3e-17 Identities = 47/66 (71%), Positives = 52/66 (78%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVVEMME G MFIDKYKYRTLFL Y KTL+K K P F SE +K+R+AAL F Sbjct: 711 GFFVRANEVVEMMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQSETQMKKREAALNF 769 Query: 1241 KEWLGL 1224 K W GL Sbjct: 770 KRWAGL 775 >XP_017624011.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium arboreum] Length = 778 Score = 95.5 bits (236), Expect = 3e-17 Identities = 45/66 (68%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV MME G MFIDKYKYRTL+L Y KTL+K KTP F +E+ +K+R+AAL F Sbjct: 713 GFFVRANEVVNMMEKGNMFIDKYKYRTLYLKYHKTLYKG-KTPKFQTESQLKKREAALSF 771 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 772 KKWIGL 777 >XP_012081315.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] XP_012081316.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] XP_012081317.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] KDP30006.1 hypothetical protein JCGZ_18578 [Jatropha curcas] Length = 780 Score = 95.5 bits (236), Expect = 3e-17 Identities = 44/66 (66%), Positives = 54/66 (81%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV+MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L F Sbjct: 716 GFFVRANEVVDMMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSF 774 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 775 KKWVGL 780 >XP_015893076.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Ziziphus jujuba] XP_015893077.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Ziziphus jujuba] XP_015893078.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Ziziphus jujuba] Length = 791 Score = 95.5 bits (236), Expect = 3e-17 Identities = 46/65 (70%), Positives = 54/65 (83%) Frame = -3 Query: 1418 FFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFK 1239 FF RANEVVEMME GKMF+DKYKYRTLFL Y KTL+K K P F +EA +K+R+AAL FK Sbjct: 727 FFNRANEVVEMMEKGKMFVDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLKKREAALAFK 785 Query: 1238 EWLGL 1224 +W+GL Sbjct: 786 KWVGL 790 >XP_011084681.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] XP_011084682.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 95.1 bits (235), Expect = 4e-17 Identities = 45/66 (68%), Positives = 54/66 (81%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVVEMME G MFIDKYKYR LFL Y KTL+K K P F +E+ +K+R+AAL F Sbjct: 706 GFFIRANEVVEMMEKGNMFIDKYKYRALFLKYHKTLYKG-KAPKFQTESQLKKREAALAF 764 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 765 KKWVGL 770 >EOX94696.1 Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 95.1 bits (235), Expect = 4e-17 Identities = 45/66 (68%), Positives = 55/66 (83%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEVV++ME G MFIDKYKYRTLFL Y KTL+K K P F +EA +K+R+AAL F Sbjct: 715 GFFVRANEVVDVMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLKKREAALTF 773 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 774 KKWVGL 779 >XP_012084287.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] XP_012084288.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] KDP27748.1 hypothetical protein JCGZ_19777 [Jatropha curcas] Length = 781 Score = 95.1 bits (235), Expect = 4e-17 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEV +MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +KRR+A L F Sbjct: 716 GFFVRANEVADMMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKRREAVLSF 774 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 775 KKWVGL 780 >XP_018833062.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Juglans regia] Length = 785 Score = 95.1 bits (235), Expect = 4e-17 Identities = 45/65 (69%), Positives = 54/65 (83%) Frame = -3 Query: 1418 FFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFK 1239 FF+RANEVVEMME G MF+DKYKYRTLFL Y KTL+K K P F +EA +K+R+AAL FK Sbjct: 721 FFVRANEVVEMMEKGNMFVDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLKKREAALTFK 779 Query: 1238 EWLGL 1224 +W+GL Sbjct: 780 KWVGL 784 >XP_004299875.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Fragaria vesca subsp. vesca] Length = 795 Score = 95.1 bits (235), Expect = 4e-17 Identities = 45/66 (68%), Positives = 53/66 (80%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF RANEV+EMME KMFIDKYKYRTLFL Y KTLHK K P F +E+ +K+R+AAL F Sbjct: 730 GFFSRANEVLEMMEKAKMFIDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAALAF 788 Query: 1241 KEWLGL 1224 K W+G+ Sbjct: 789 KNWIGV 794 >XP_012084286.1 PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] Length = 798 Score = 95.1 bits (235), Expect = 5e-17 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = -3 Query: 1421 GFFLRANEVVEMMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLF 1242 GFF+RANEV +MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +KRR+A L F Sbjct: 733 GFFVRANEVADMMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKRREAVLSF 791 Query: 1241 KEWLGL 1224 K+W+GL Sbjct: 792 KKWVGL 797