BLASTX nr result
ID: Papaver32_contig00011963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00011963 (736 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDJ49318.1 hypothetical protein EBH_0082990 [Eimeria brunetti] 57 3e-06 >CDJ49318.1 hypothetical protein EBH_0082990 [Eimeria brunetti] Length = 267 Score = 57.4 bits (137), Expect = 3e-06 Identities = 51/198 (25%), Positives = 69/198 (34%), Gaps = 4/198 (2%) Frame = -1 Query: 703 QQAPYQNLPPKSPME*HTQ*LCHPYPPQNPPHTQNLFLHLKQQSEA----EACPYPSLRN 536 QQ P Q+L P H Q HP+ Q PH Q H Q + + P+ + Sbjct: 56 QQHPQQHLQPHQ----HHQQQQHPHQQQQHPHQQQQHPHQPHQQQQHPHQQQHPHQQQPH 111 Query: 535 LRQSQ*PHLHQGQSQVLKQHPNQHHRSHYHYPQNLPQHPNFFQNHKPCQTVHLD*FLHFQ 356 +Q H HQ Q Q + H + HH H+HY Q Q + +H H Q Sbjct: 112 QQQQHHHHHHQQQQQQQEHHHHHHHHHHHHYQQQQQQQQHHHHHH------------HNQ 159 Query: 355 *YLFPPSILHYLHKSIQLQLPHSLQGY*LLLEPNFHELQYLQLNCYPVLHHILQEYPFLL 176 H+ H Q PH Q + + H+ Q Q HH + Sbjct: 160 ---------HHQHHHQQQHHPHQQQHH------HQHQQQQQQQQQQHHHHHHHHHHNHQH 204 Query: 175 HIPWKQPQFFHHHCHQSR 122 H Q HHH H + Sbjct: 205 HNQHHQHHNQHHHHHNQQ 222