BLASTX nr result
ID: Papaver32_contig00010813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00010813 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001030765.1 glyoxylate reductase 1 [Arabidopsis thaliana] AEE... 61 3e-08 NP_566768.1 glyoxylate reductase 1 [Arabidopsis thaliana] Q9LSV0... 61 3e-08 XP_010488656.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 61 3e-08 XP_010466966.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 61 3e-08 XP_010514225.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 61 3e-08 KFK39847.1 hypothetical protein AALP_AA3G295900 [Arabis alpina] 61 3e-08 XP_002885728.1 6-phosphogluconate dehydrogenase NAD-binding doma... 61 3e-08 AAK94781.1 gamma hydroxybutyrate dehydrogenase [Arabidopsis thal... 61 3e-08 3DOJ_A Chain A, Structure Of Glyoxylate Reductase 1 From Arabido... 61 3e-08 XP_006298016.1 hypothetical protein CARUB_v10014060mg [Capsella ... 60 5e-08 XP_018486196.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 60 5e-08 XP_009102475.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 60 5e-08 XP_013726567.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 60 5e-08 XP_013614926.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 60 5e-08 JAV01310.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea... 60 7e-08 JAU48775.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea... 60 7e-08 JAU25568.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea... 60 7e-08 BAH19592.1 AT3G25530 [Arabidopsis thaliana] 59 9e-08 XP_006418699.1 hypothetical protein EUTSA_v10002631mg [Eutrema s... 59 1e-07 XP_012084135.1 PREDICTED: glyoxylate/succinic semialdehyde reduc... 57 5e-07 >NP_001030765.1 glyoxylate reductase 1 [Arabidopsis thaliana] AEE77022.1 glyoxylate reductase 1 [Arabidopsis thaliana] Length = 278 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 242 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 278 >NP_566768.1 glyoxylate reductase 1 [Arabidopsis thaliana] Q9LSV0.1 RecName: Full=Glyoxylate/succinic semialdehyde reductase 1; Short=AtGLYR1; Short=AtGR1; Short=SSA reductase 1; AltName: Full=Gamma-hydroxybutyrate dehydrogenase; Short=AtGHBDH BAB01322.1 dehydrogenase-like protein [Arabidopsis thaliana] ABE02414.1 At3g25530 [Arabidopsis thaliana] AEE77021.1 glyoxylate reductase 1 [Arabidopsis thaliana] OAP06236.1 GR1 [Arabidopsis thaliana] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >XP_010488656.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Camelina sativa] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >XP_010466966.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Camelina sativa] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >XP_010514225.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Camelina sativa] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >KFK39847.1 hypothetical protein AALP_AA3G295900 [Arabis alpina] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >XP_002885728.1 6-phosphogluconate dehydrogenase NAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] EFH61987.1 6-phosphogluconate dehydrogenase NAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >AAK94781.1 gamma hydroxybutyrate dehydrogenase [Arabidopsis thaliana] Length = 289 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 289 >3DOJ_A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK SR+ Sbjct: 274 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE 310 >XP_006298016.1 hypothetical protein CARUB_v10014060mg [Capsella rubella] EOA30914.1 hypothetical protein CARUB_v10014060mg [Capsella rubella] Length = 355 Score = 60.5 bits (145), Expect = 5e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EA+K SR+ Sbjct: 319 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAIKFSRE 355 >XP_018486196.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Raphanus sativus] XP_018486228.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Raphanus sativus] Length = 289 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARS+ LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSRE 289 >XP_009102475.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Brassica rapa] XP_013662969.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 isoform X1 [Brassica napus] XP_013662970.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 isoform X2 [Brassica napus] Length = 289 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARS+ LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSRE 289 >XP_013726567.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1-like [Brassica napus] Length = 290 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARS+ LGD DFSAV+EAVK SR+ Sbjct: 253 SMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSRE 289 >XP_013614926.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Brassica oleracea var. oleracea] Length = 290 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARS+ LGD DFSAV+EAVK SR+ Sbjct: 254 SMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSRE 290 >JAV01310.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea caerulescens] Length = 289 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK S++ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSKE 289 >JAU48775.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea caerulescens] Length = 289 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK S++ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSKE 289 >JAU25568.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea caerulescens] JAU57148.1 Glyoxylate/succinic semialdehyde reductase 1 [Noccaea caerulescens] Length = 289 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV+EAVK S++ Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSKE 289 >BAH19592.1 AT3G25530 [Arabidopsis thaliana] Length = 278 Score = 59.3 bits (142), Expect = 9e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANE FK ARSL LGD DFSAV+EAVK SR+ Sbjct: 242 SMPVAAAANEVFKKARSLGLGDLDFSAVIEAVKFSRE 278 >XP_006418699.1 hypothetical protein EUTSA_v10002631mg [Eutrema salsugineum] ESQ37135.1 hypothetical protein EUTSA_v10002631mg [Eutrema salsugineum] Length = 289 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARS+ LGD DFSAV+EAVK S++ Sbjct: 253 SMPVAAAANEAFKKARSMGLGDLDFSAVIEAVKFSKE 289 >XP_012084135.1 PREDICTED: glyoxylate/succinic semialdehyde reductase 1 [Jatropha curcas] KDP45174.1 hypothetical protein JCGZ_15039 [Jatropha curcas] Length = 289 Score = 57.4 bits (137), Expect = 5e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 420 SMPVAAAANEAFKTARSLELGDFDFSAVLEAVKVSRD 310 SMPVAAAANEAFK ARSL LGD DFSAV E VK+ +D Sbjct: 253 SMPVAAAANEAFKKARSLGLGDLDFSAVYEVVKMHKD 289