BLASTX nr result
ID: Papaver32_contig00010697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00010697 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEZ00848.1 putative cullin protein, partial [Elaeis guineensis] 112 7e-30 BAP11200.1 putative cullin 1, partial [Zanthoxylum ailanthoides]... 110 4e-29 XP_018723641.1 PREDICTED: cullin-1-like [Eucalyptus grandis] 110 4e-29 XP_016498674.1 PREDICTED: cullin-1-like [Nicotiana tabacum] 108 4e-28 JAU82996.1 Cullin-2, partial [Noccaea caerulescens] 105 3e-27 EEF27144.1 conserved hypothetical protein [Ricinus communis] 108 4e-27 ACJ85612.1 unknown [Medicago truncatula] AFK40323.1 unknown [Med... 107 6e-27 KHG15267.1 Cullin-1 -like protein [Gossypium arboreum] 114 7e-27 XP_017642461.1 PREDICTED: cullin-1-like [Gossypium arboreum] XP_... 114 7e-27 XP_011625261.1 PREDICTED: cullin-1 [Amborella trichopoda] 113 1e-26 ERM95114.1 hypothetical protein AMTR_s00009p00258510 [Amborella ... 113 1e-26 XP_008802121.1 PREDICTED: cullin-1-like [Phoenix dactylifera] XP... 113 2e-26 XP_018462966.1 PREDICTED: LOW QUALITY PROTEIN: cullin-2-like, pa... 103 2e-26 EOY06477.1 Cullin 1 isoform 3 [Theobroma cacao] 112 2e-26 KHG10589.1 Cullin-1 -like protein [Gossypium arboreum] 112 2e-26 XP_019075657.1 PREDICTED: cullin-1 isoform X2 [Vitis vinifera] 112 2e-26 XP_017611107.1 PREDICTED: cullin-1-like [Gossypium arboreum] 112 2e-26 XP_016668687.1 PREDICTED: cullin-1-like [Gossypium hirsutum] 112 2e-26 XP_017975508.1 PREDICTED: cullin-1 [Theobroma cacao] 112 2e-26 ANC90259.1 cullin 1 [Vitis pseudoreticulata] 112 2e-26 >AEZ00848.1 putative cullin protein, partial [Elaeis guineensis] Length = 91 Score = 112 bits (280), Expect = 7e-30 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QLNRMFKPDFK IKKRIEDLITRDYLERDKDNPN FR Sbjct: 29 SIVRIMKSRKVLGHQQLVLECVEQLNRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFR 88 Query: 225 YLA 217 YLA Sbjct: 89 YLA 91 >BAP11200.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11201.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11202.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11203.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11204.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11205.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11206.1 putative cullin 1, partial [Zanthoxylum ailanthoides] BAP11207.1 putative cullin 1, partial [Zanthoxylum ailanthoides] Length = 89 Score = 110 bits (275), Expect = 4e-29 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDK NPNTFR Sbjct: 27 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKSNPNTFR 86 Query: 225 YLA 217 YLA Sbjct: 87 YLA 89 >XP_018723641.1 PREDICTED: cullin-1-like [Eucalyptus grandis] Length = 94 Score = 110 bits (275), Expect = 4e-29 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPN FR Sbjct: 32 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNLFR 91 Query: 225 YLA 217 YLA Sbjct: 92 YLA 94 >XP_016498674.1 PREDICTED: cullin-1-like [Nicotiana tabacum] Length = 111 Score = 108 bits (270), Expect = 4e-28 Identities = 53/63 (84%), Positives = 56/63 (88%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL Y QL+ ECV+QL RMFKPD K IKKRIEDLITRDYLERDKDNPN F+ Sbjct: 49 SIVRIMKSRKVLGYQQLVMECVEQLGRMFKPDVKAIKKRIEDLITRDYLERDKDNPNLFK 108 Query: 225 YLA 217 YLA Sbjct: 109 YLA 111 >JAU82996.1 Cullin-2, partial [Noccaea caerulescens] Length = 92 Score = 105 bits (263), Expect = 3e-27 Identities = 48/63 (76%), Positives = 59/63 (93%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 ++VRIMKSRKVLP+ QL+SECV+ L++MFKPD K+IKKRIEDLITRDYLERD +NPNTF+ Sbjct: 30 ALVRIMKSRKVLPHQQLVSECVEHLSKMFKPDIKMIKKRIEDLITRDYLERDTENPNTFK 89 Query: 225 YLA 217 Y+A Sbjct: 90 YVA 92 >EEF27144.1 conserved hypothetical protein [Ricinus communis] Length = 211 Score = 108 bits (271), Expect = 4e-27 Identities = 52/63 (82%), Positives = 59/63 (93%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 +IVRIMKSRKVL + QL+SECV+QL+RMFKPD K IKKR+EDLITRDYLERDK+NPNTFR Sbjct: 149 AIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNTFR 208 Query: 225 YLA 217 YLA Sbjct: 209 YLA 211 >ACJ85612.1 unknown [Medicago truncatula] AFK40323.1 unknown [Medicago truncatula] Length = 169 Score = 107 bits (267), Expect = 6e-27 Identities = 52/63 (82%), Positives = 57/63 (90%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 +IVRIMKSRKVL + QL+ ECV+QL RMFKPD K IKKRIEDLITRDYLERDK+NPNTFR Sbjct: 107 AIVRIMKSRKVLGHQQLVLECVEQLGRMFKPDIKAIKKRIEDLITRDYLERDKENPNTFR 166 Query: 225 YLA 217 YLA Sbjct: 167 YLA 169 >KHG15267.1 Cullin-1 -like protein [Gossypium arboreum] Length = 696 Score = 114 bits (285), Expect = 7e-27 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK+IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 634 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKVIKKRIEDLITRDYLERDKDNPNTFR 693 Query: 225 YLA 217 YLA Sbjct: 694 YLA 696 >XP_017642461.1 PREDICTED: cullin-1-like [Gossypium arboreum] XP_017642462.1 PREDICTED: cullin-1-like [Gossypium arboreum] Length = 744 Score = 114 bits (285), Expect = 7e-27 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK+IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 682 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKVIKKRIEDLITRDYLERDKDNPNTFR 741 Query: 225 YLA 217 YLA Sbjct: 742 YLA 744 >XP_011625261.1 PREDICTED: cullin-1 [Amborella trichopoda] Length = 744 Score = 113 bits (283), Expect = 1e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL Y QL+ ECV+QL RMFKPDFK IKKRIEDLITR+YLERDKDNPNTFR Sbjct: 682 SIVRIMKSRKVLSYQQLVMECVEQLGRMFKPDFKAIKKRIEDLITREYLERDKDNPNTFR 741 Query: 225 YLA 217 YLA Sbjct: 742 YLA 744 >ERM95114.1 hypothetical protein AMTR_s00009p00258510 [Amborella trichopoda] Length = 761 Score = 113 bits (283), Expect = 1e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL Y QL+ ECV+QL RMFKPDFK IKKRIEDLITR+YLERDKDNPNTFR Sbjct: 699 SIVRIMKSRKVLSYQQLVMECVEQLGRMFKPDFKAIKKRIEDLITREYLERDKDNPNTFR 758 Query: 225 YLA 217 YLA Sbjct: 759 YLA 761 >XP_008802121.1 PREDICTED: cullin-1-like [Phoenix dactylifera] XP_017700425.1 PREDICTED: cullin-1-like [Phoenix dactylifera] Length = 744 Score = 113 bits (282), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QLNRMFKPDFK IKKRIEDLITRDYLERDKDNPN FR Sbjct: 682 SIVRIMKSRKVLGHQQLVMECVEQLNRMFKPDFKAIKKRIEDLITRDYLERDKDNPNVFR 741 Query: 225 YLA 217 YLA Sbjct: 742 YLA 744 >XP_018462966.1 PREDICTED: LOW QUALITY PROTEIN: cullin-2-like, partial [Raphanus sativus] Length = 102 Score = 103 bits (258), Expect = 2e-26 Identities = 48/63 (76%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 S+VRIMKS KVLP+ L+SECV+QL+RMFKPD K+IKKRIEDLI+RDYLERD +NPNTF+ Sbjct: 40 SLVRIMKSXKVLPHQXLVSECVEQLSRMFKPDIKMIKKRIEDLISRDYLERDTENPNTFK 99 Query: 225 YLA 217 Y+A Sbjct: 100 YVA 102 >EOY06477.1 Cullin 1 isoform 3 [Theobroma cacao] Length = 693 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 631 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 690 Query: 225 YLA 217 YLA Sbjct: 691 YLA 693 >KHG10589.1 Cullin-1 -like protein [Gossypium arboreum] Length = 697 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 635 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 694 Query: 225 YLA 217 YLA Sbjct: 695 YLA 697 >XP_019075657.1 PREDICTED: cullin-1 isoform X2 [Vitis vinifera] Length = 741 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 679 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 738 Query: 225 YLA 217 YLA Sbjct: 739 YLA 741 >XP_017611107.1 PREDICTED: cullin-1-like [Gossypium arboreum] Length = 742 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 680 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 739 Query: 225 YLA 217 YLA Sbjct: 740 YLA 742 >XP_016668687.1 PREDICTED: cullin-1-like [Gossypium hirsutum] Length = 742 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 680 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 739 Query: 225 YLA 217 YLA Sbjct: 740 YLA 742 >XP_017975508.1 PREDICTED: cullin-1 [Theobroma cacao] Length = 744 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 682 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 741 Query: 225 YLA 217 YLA Sbjct: 742 YLA 744 >ANC90259.1 cullin 1 [Vitis pseudoreticulata] Length = 744 Score = 112 bits (281), Expect = 2e-26 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 405 SIVRIMKSRKVLPYHQLLSECVDQLNRMFKPDFKIIKKRIEDLITRDYLERDKDNPNTFR 226 SIVRIMKSRKVL + QL+ ECV+QL RMFKPDFK IKKRIEDLITRDYLERDKDNPNTFR Sbjct: 682 SIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERDKDNPNTFR 741 Query: 225 YLA 217 YLA Sbjct: 742 YLA 744