BLASTX nr result
ID: Papaver32_contig00010664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00010664 (625 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO71915.1 hypothetical protein CISIN_1g020053mg [Citrus sinensis] 86 1e-16 XP_006488848.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Ci... 86 1e-16 XP_006419397.1 hypothetical protein CICLE_v10005518mg [Citrus cl... 86 1e-16 OAY27662.1 hypothetical protein MANES_15G005200 [Manihot esculenta] 86 2e-16 AFK49409.1 unknown [Lotus japonicus] 86 2e-16 XP_008438945.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Cu... 86 2e-16 XP_004134243.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Cu... 86 2e-16 KDO71913.1 hypothetical protein CISIN_1g020053mg [Citrus sinensis] 86 2e-16 XP_017220506.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-lik... 85 3e-16 KVH96432.1 Ubiquitin-conjugating enzyme, E2 [Cynara cardunculus ... 86 4e-16 KZM82898.1 hypothetical protein DCAR_030467 [Daucus carota subsp... 85 4e-16 OAY56107.1 hypothetical protein MANES_03G203400 [Manihot esculen... 85 4e-16 OEL18789.1 Ubiquitin-conjugating enzyme E2 32 [Dichanthelium oli... 85 4e-16 XP_017227008.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-lik... 85 5e-16 KHN12876.1 Ubiquitin-conjugating enzyme E2 32 [Glycine soja] 84 6e-16 XP_011010307.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-lik... 84 6e-16 XP_002314941.1 ubiquitin-conjugating enzyme family protein [Popu... 84 6e-16 XP_003533168.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-lik... 84 6e-16 XP_002519212.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Ri... 84 6e-16 XP_007147358.1 hypothetical protein PHAVU_006G117400g [Phaseolus... 84 6e-16 >KDO71915.1 hypothetical protein CISIN_1g020053mg [Citrus sinensis] Length = 293 Score = 85.9 bits (211), Expect = 1e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LA+KSREAAPK+GTPERQ+LIDE+ E Sbjct: 113 MPTNPNGALGSLDYKKEERRALAIKSREAAPKFGTPERQKLIDEIHE 159 >XP_006488848.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Citrus sinensis] KDO71914.1 hypothetical protein CISIN_1g020053mg [Citrus sinensis] Length = 301 Score = 85.9 bits (211), Expect = 1e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LA+KSREAAPK+GTPERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRALAIKSREAAPKFGTPERQKLIDEIHE 167 >XP_006419397.1 hypothetical protein CICLE_v10005518mg [Citrus clementina] ESR32637.1 hypothetical protein CICLE_v10005518mg [Citrus clementina] Length = 301 Score = 85.9 bits (211), Expect = 1e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LA+KSREAAPK+GTPERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRALAIKSREAAPKFGTPERQKLIDEIHE 167 >OAY27662.1 hypothetical protein MANES_15G005200 [Manihot esculenta] Length = 308 Score = 85.9 bits (211), Expect = 2e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPTNP GALGSLDYKKEERRVLA+KSREAAP++GTPERQ+LIDE+ Sbjct: 121 MPTNPNGALGSLDYKKEERRVLAIKSREAAPRFGTPERQKLIDEI 165 >AFK49409.1 unknown [Lotus japonicus] Length = 311 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LA+KSREA+PK+GTPERQRLIDE+ E Sbjct: 120 MPTNPNGALGSLDYKKEERRALAIKSREASPKFGTPERQRLIDEIHE 166 >XP_008438945.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Cucumis melo] Length = 297 Score = 85.5 bits (210), Expect = 2e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERRVLA+KSREA PK+GTPERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRVLAIKSREAPPKFGTPERQKLIDEIHE 167 >XP_004134243.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Cucumis sativus] KGN57162.1 hypothetical protein Csa_3G166270 [Cucumis sativus] Length = 297 Score = 85.5 bits (210), Expect = 2e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERRVLA+KSREA PK+GTPERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRVLAIKSREAPPKFGTPERQKLIDEIHE 167 >KDO71913.1 hypothetical protein CISIN_1g020053mg [Citrus sinensis] Length = 332 Score = 85.9 bits (211), Expect = 2e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LA+KSREAAPK+GTPERQ+LIDE+ E Sbjct: 152 MPTNPNGALGSLDYKKEERRALAIKSREAAPKFGTPERQKLIDEIHE 198 >XP_017220506.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Daucus carota subsp. sativus] KZM85577.1 hypothetical protein DCAR_027001 [Daucus carota subsp. sativus] Length = 305 Score = 85.1 bits (209), Expect = 3e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPTNP GALGSLDYKKEERRVLAVKSREAAPK+G PERQ+LIDE+ Sbjct: 121 MPTNPNGALGSLDYKKEERRVLAVKSREAAPKFGNPERQQLIDEI 165 >KVH96432.1 Ubiquitin-conjugating enzyme, E2 [Cynara cardunculus var. scolymus] Length = 356 Score = 85.5 bits (210), Expect = 4e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPT+P GALGSLDYKKEERRVLA+KSREAAPK+GTP+RQRLIDE+ E Sbjct: 176 MPTSPNGALGSLDYKKEERRVLAIKSREAAPKFGTPDRQRLIDEIHE 222 >KZM82898.1 hypothetical protein DCAR_030467 [Daucus carota subsp. sativus] KZM82906.1 hypothetical protein DCAR_030475 [Daucus carota subsp. sativus] Length = 305 Score = 84.7 bits (208), Expect = 4e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERRVLA+KSREAAPK+G PERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRVLALKSREAAPKFGNPERQKLIDEIHE 167 >OAY56107.1 hypothetical protein MANES_03G203400 [Manihot esculenta] OAY56108.1 hypothetical protein MANES_03G203400 [Manihot esculenta] OAY56109.1 hypothetical protein MANES_03G203400 [Manihot esculenta] OAY56110.1 hypothetical protein MANES_03G203400 [Manihot esculenta] Length = 309 Score = 84.7 bits (208), Expect = 4e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERRVLAVKSREA P++GTPERQ+LIDE+ E Sbjct: 121 MPTNPNGALGSLDYKKEERRVLAVKSREAPPRFGTPERQKLIDEIHE 167 >OEL18789.1 Ubiquitin-conjugating enzyme E2 32 [Dichanthelium oligosanthes] Length = 311 Score = 84.7 bits (208), Expect = 4e-16 Identities = 38/45 (84%), Positives = 44/45 (97%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPTNPGGALGSLDYKKE+RRVLA+KSREA PK+G+PERQ+LIDE+ Sbjct: 122 MPTNPGGALGSLDYKKEDRRVLAIKSREAPPKFGSPERQKLIDEI 166 >XP_017227008.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Daucus carota subsp. sativus] XP_017227034.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Daucus carota subsp. sativus] Length = 331 Score = 84.7 bits (208), Expect = 5e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERRVLA+KSREAAPK+G PERQ+LIDE+ E Sbjct: 147 MPTNPNGALGSLDYKKEERRVLALKSREAAPKFGNPERQKLIDEIHE 193 >KHN12876.1 Ubiquitin-conjugating enzyme E2 32 [Glycine soja] Length = 305 Score = 84.3 bits (207), Expect = 6e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LAVKSREA PK+GTPERQ+LIDE+ E Sbjct: 117 MPTNPNGALGSLDYKKEERRTLAVKSREAPPKFGTPERQKLIDEIHE 163 >XP_011010307.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Populus euphratica] Length = 308 Score = 84.3 bits (207), Expect = 6e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPT+P GALGSLDYKKEERRVLAVKSREAAP++GTPERQ+LIDE+ Sbjct: 121 MPTSPNGALGSLDYKKEERRVLAVKSREAAPRFGTPERQKLIDEI 165 >XP_002314941.1 ubiquitin-conjugating enzyme family protein [Populus trichocarpa] EEF01112.1 ubiquitin-conjugating enzyme family protein [Populus trichocarpa] Length = 308 Score = 84.3 bits (207), Expect = 6e-16 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPT+P GALGSLDYKKEERRVLAVKSREAAP++GTPERQ+LIDE+ Sbjct: 121 MPTSPNGALGSLDYKKEERRVLAVKSREAAPRFGTPERQKLIDEI 165 >XP_003533168.1 PREDICTED: ubiquitin-conjugating enzyme E2 32-like [Glycine max] KRH36981.1 hypothetical protein GLYMA_09G036300 [Glycine max] Length = 308 Score = 84.3 bits (207), Expect = 6e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LAVKSREA PK+GTPERQ+LIDE+ E Sbjct: 120 MPTNPNGALGSLDYKKEERRTLAVKSREAPPKFGTPERQKLIDEIHE 166 >XP_002519212.1 PREDICTED: ubiquitin-conjugating enzyme E2 32 [Ricinus communis] EEF43076.1 non-canonical ubiquitin conjugating enzyme, putative [Ricinus communis] Length = 309 Score = 84.3 bits (207), Expect = 6e-16 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL 552 MPTNP GALGSLDYKKEERR LA+KSREAAP++GTPERQ+LIDE+ Sbjct: 121 MPTNPNGALGSLDYKKEERRALAIKSREAAPRFGTPERQKLIDEI 165 >XP_007147358.1 hypothetical protein PHAVU_006G117400g [Phaseolus vulgaris] ESW19352.1 hypothetical protein PHAVU_006G117400g [Phaseolus vulgaris] Length = 309 Score = 84.3 bits (207), Expect = 6e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 418 MPTNPGGALGSLDYKKEERRVLAVKSREAAPKYGTPERQRLIDEL*E 558 MPTNP GALGSLDYKKEERR LAVKSREA PK+GTPERQ+LIDE+ E Sbjct: 120 MPTNPNGALGSLDYKKEERRTLAVKSREAPPKFGTPERQKLIDEIHE 166