BLASTX nr result
ID: Papaver32_contig00009907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00009907 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011030267.1 PREDICTED: uncharacterized protein At3g49720-like... 55 2e-06 XP_011030264.1 PREDICTED: uncharacterized protein At3g49720-like... 55 2e-06 XP_002300295.1 hypothetical protein POPTR_0001s29510g [Populus t... 55 3e-06 XP_002313939.1 hypothetical protein POPTR_0009s08600g [Populus t... 54 5e-06 XP_011002655.1 PREDICTED: uncharacterized protein At3g49720-like... 54 7e-06 >XP_011030267.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] XP_011030268.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] Length = 262 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 179 MSRRPGNPARRFGESGGIPFASSLHQKSRSSP 84 MSRRPGNPARR+ + G +PFA S+H KSRSSP Sbjct: 1 MSRRPGNPARRYADGGSLPFAGSMHSKSRSSP 32 >XP_011030264.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] XP_011030265.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] Length = 262 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 179 MSRRPGNPARRFGESGGIPFASSLHQKSRSSP 84 MSRRPGNPARR+ + G +PFA S+H KSRSSP Sbjct: 1 MSRRPGNPARRYADGGSLPFAGSMHSKSRSSP 32 >XP_002300295.1 hypothetical protein POPTR_0001s29510g [Populus trichocarpa] XP_006369709.1 hypothetical protein POPTR_0001s29510g [Populus trichocarpa] ABK94014.1 unknown [Populus trichocarpa] EEE85100.1 hypothetical protein POPTR_0001s29510g [Populus trichocarpa] ERP66278.1 hypothetical protein POPTR_0001s29510g [Populus trichocarpa] Length = 262 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 179 MSRRPGNPARRFGESGGIPFASSLHQKSRSSP 84 MSRRPGNPARRF + G +PF S+H KSRSSP Sbjct: 1 MSRRPGNPARRFADGGSLPFVGSMHSKSRSSP 32 >XP_002313939.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] XP_006379151.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] XP_006379152.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] ABK93823.1 unknown [Populus trichocarpa] EEE87894.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] ERP56948.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] ERP56949.1 hypothetical protein POPTR_0009s08600g [Populus trichocarpa] Length = 262 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 179 MSRRPGNPARRFGESGGIPFASSLHQKSRSSP 84 MSRRPGNPARR + G +PFA S+H KSRSSP Sbjct: 1 MSRRPGNPARRLADGGSLPFAGSMHSKSRSSP 32 >XP_011002655.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] XP_011002661.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] XP_011002668.1 PREDICTED: uncharacterized protein At3g49720-like [Populus euphratica] Length = 262 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 179 MSRRPGNPARRFGESGGIPFASSLHQKSRSSP 84 MSRRPGNPARR + G +PFA S+H KSRSSP Sbjct: 1 MSRRPGNPARRLADGGSLPFAGSVHSKSRSSP 32