BLASTX nr result
ID: Papaver32_contig00009653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00009653 (901 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJX93220.1 hypothetical protein TI39_contig4362g00002 [Zymosepto... 55 1e-06 >KJX93220.1 hypothetical protein TI39_contig4362g00002 [Zymoseptoria brevis] Length = 68 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +2 Query: 98 LYQSACLYASVTAFSATWVALALPIQHGKAGPFNYHRAIKRGAR-IPW-RRIPGM 256 LY A + + +AF+A WV + LP+QH K GP++YHR K AR P+ RR+P M Sbjct: 13 LYNGAAFFGTCSAFAAFWVGVRLPVQHNKQGPYHYHRLAKAAARKAPYLRRLPKM 67