BLASTX nr result
ID: Papaver32_contig00004947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00004947 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016558791.1 PREDICTED: UDP-N-acetylenolpyruvoylglucosamine re... 54 6e-06 >XP_016558791.1 PREDICTED: UDP-N-acetylenolpyruvoylglucosamine reductase-like [Capsicum annuum] Length = 195 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 298 GL*RIHQKQLGSMKLSTWRIGGPCNYFVQVFDRTQLLSAI 417 GL IH+K+L S L+TW IGGPCNYF+QVF+ TQL+SA+ Sbjct: 42 GLRFIHRKKLLS-DLTTWGIGGPCNYFIQVFNHTQLVSAL 80