BLASTX nr result
ID: Papaver32_contig00004309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00004309 (541 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018029470.1 hypothetical protein CC84DRAFT_1223387 [Paraphaeo... 58 3e-07 >XP_018029470.1 hypothetical protein CC84DRAFT_1223387 [Paraphaeosphaeria sporulosa] OAF99104.1 hypothetical protein CC84DRAFT_1223387 [Paraphaeosphaeria sporulosa] Length = 166 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -3 Query: 446 MRFSTTXXXXXXXXXXXXFPQDVKPITQISDGQIQAPPATAAPSSGY 306 MRFST+ PQDV+PITQISDGQIQAPPAT+AP+ Y Sbjct: 1 MRFSTSAIFAAVAIGAQALPQDVQPITQISDGQIQAPPATSAPAGSY 47