BLASTX nr result
ID: Papaver32_contig00004196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00004196 (453 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020097865.1 uncharacterized protein LOC109716720 [Ananas como... 47 2e-07 XP_009412141.1 PREDICTED: uncharacterized protein LOC103993700 i... 45 8e-06 >XP_020097865.1 uncharacterized protein LOC109716720 [Ananas comosus] OAY84463.1 hypothetical protein ACMD2_03885 [Ananas comosus] Length = 86 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 18/33 (54%), Positives = 27/33 (81%) Frame = +1 Query: 157 IATDNKDVLTYIQRLGIKRVVLPVLPTRCSGKF 255 + T N+++L ++Q L IK+++ PVLPTRCSGKF Sbjct: 54 VDTGNEEILLFVQSLNIKQILTPVLPTRCSGKF 86 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +2 Query: 77 LQPPSLLSLAIESGIRNISRIPD 145 +QPPSLLSLAI+S + +IS IPD Sbjct: 1 MQPPSLLSLAIDSAVLHISAIPD 23 >XP_009412141.1 PREDICTED: uncharacterized protein LOC103993700 isoform X3 [Musa acuminata subsp. malaccensis] Length = 86 Score = 45.4 bits (106), Expect(2) = 8e-06 Identities = 19/33 (57%), Positives = 26/33 (78%) Frame = +1 Query: 157 IATDNKDVLTYIQRLGIKRVVLPVLPTRCSGKF 255 +AT N+D+L+++ RL IK + PVLPTRCS KF Sbjct: 54 MATGNEDILSFVHRLNIKPTLTPVLPTRCSEKF 86 Score = 31.6 bits (70), Expect(2) = 8e-06 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +2 Query: 77 LQPPSLLSLAIESGIRNISRIPD 145 +QPP+LLSL I+S +R+I+ I D Sbjct: 1 MQPPTLLSLTIDSALRHIAHIAD 23