BLASTX nr result
ID: Papaver32_contig00003213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00003213 (1276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ADC80686.1 Sec13-like protein, partial [Populus tremula x Populu... 62 6e-08 ADC80684.1 Sec13-like protein, partial [Populus tremula x Populu... 62 6e-08 KZV06830.1 hypothetical protein F511_45689 [Dorcoceras hygrometr... 62 1e-07 XP_007032314.2 PREDICTED: protein transport protein SEC13 homolo... 64 1e-07 EOY03240.1 Transducin family protein / WD-40 repeat family prote... 64 1e-07 ADC80692.1 Sec13-like protein, partial [Tachigali melinonii] ADC... 61 2e-07 ADC80691.1 Sec13-like protein, partial [Tachigali melinonii] 61 2e-07 ADC80690.1 Sec13-like protein, partial [Tachigali melinonii] 61 2e-07 ADC80670.1 Sec13-like protein, partial [Bauhinia purpurea] ADD10... 61 2e-07 ADC80669.1 Sec13-like protein, partial [Bauhinia purpurea] ADC80... 61 2e-07 ADC80668.1 Sec13-like protein, partial [Bauhinia purpurea] 61 2e-07 ADC80666.1 Sec13-like protein, partial [Phanera guianensis] 61 2e-07 ADC80662.1 Sec13-like protein, partial [Phanera guianensis] ADC8... 61 2e-07 ADC80661.1 Sec13-like protein, partial [Phanera guianensis] ADC8... 61 2e-07 ADC80660.1 Sec13-like protein, partial [Phanera guianensis] 61 2e-07 ADC80659.1 Sec13-like protein, partial [Phanera guianensis] 61 2e-07 ADC80658.1 Sec13-like protein, partial [Phanera guianensis] 61 2e-07 KNA23379.1 hypothetical protein SOVF_025400 [Spinacia oleracea] 63 2e-07 ADC80685.1 Sec13-like protein, partial [Populus tremula x Populu... 60 2e-07 ADC80667.1 Sec13-like protein, partial [Bauhinia purpurea] 60 2e-07 >ADC80686.1 Sec13-like protein, partial [Populus tremula x Populus alba] ADC80688.1 Sec13-like protein, partial [Populus tremula x Populus alba] Length = 155 Score = 62.0 bits (149), Expect = 6e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVGSGLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGSGLLDPVQKLCSGG 68 >ADC80684.1 Sec13-like protein, partial [Populus tremula x Populus alba] Length = 155 Score = 62.0 bits (149), Expect = 6e-08 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVGSGLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGSGLLDPVQKLCSGG 68 >KZV06830.1 hypothetical protein F511_45689 [Dorcoceras hygrometricum] Length = 168 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL P+QKL SGG Sbjct: 18 PVGVTSVSWAPATAPGALVGTGLLDPIQKLASGG 51 >XP_007032314.2 PREDICTED: protein transport protein SEC13 homolog B [Theobroma cacao] Length = 301 Score = 63.5 bits (153), Expect = 1e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGGF 3 PVG TSVSWAP TAPGALVGSGLL PVQKL SGG+ Sbjct: 149 PVGVTSVSWAPSTAPGALVGSGLLDPVQKLASGGY 183 >EOY03240.1 Transducin family protein / WD-40 repeat family protein [Theobroma cacao] Length = 301 Score = 63.5 bits (153), Expect = 1e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGGF 3 PVG TSVSWAP TAPGALVGSGLL PVQKL SGG+ Sbjct: 149 PVGVTSVSWAPSTAPGALVGSGLLDPVQKLASGGY 183 >ADC80692.1 Sec13-like protein, partial [Tachigali melinonii] ADC80694.1 Sec13-like protein, partial [Tachigali melinonii] ADD11001.1 Sec 13 transport-like protein, partial [Tachigali melinonii] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGTGLLDPVQKLCSGG 68 >ADC80691.1 Sec13-like protein, partial [Tachigali melinonii] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGTGLLDPVQKLCSGG 68 >ADC80690.1 Sec13-like protein, partial [Tachigali melinonii] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGTGLLDPVQKLCSGG 68 >ADC80670.1 Sec13-like protein, partial [Bauhinia purpurea] ADD10998.1 Sec 13 transport-like protein, partial [Bauhinia purpurea] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80669.1 Sec13-like protein, partial [Bauhinia purpurea] ADC80671.1 Sec13-like protein, partial [Bauhinia purpurea] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80668.1 Sec13-like protein, partial [Bauhinia purpurea] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80666.1 Sec13-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80662.1 Sec13-like protein, partial [Phanera guianensis] ADC80663.1 Sec13-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80661.1 Sec13-like protein, partial [Phanera guianensis] ADC80664.1 Sec13-like protein, partial [Phanera guianensis] ADC80665.1 Sec13-like protein, partial [Phanera guianensis] ADD10997.1 Sec 13 transport-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80660.1 Sec13-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80659.1 Sec13-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >ADC80658.1 Sec13-like protein, partial [Phanera guianensis] Length = 155 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGVTSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68 >KNA23379.1 hypothetical protein SOVF_025400 [Spinacia oleracea] Length = 302 Score = 63.2 bits (152), Expect(2) = 2e-07 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVGSGLL PV KLVSGG Sbjct: 150 PVGVTSVSWAPATAPGALVGSGLLEPVHKLVSGG 183 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -2 Query: 138 TIKIDQAHPV 109 T KIDQAHPV Sbjct: 142 TNKIDQAHPV 151 >ADC80685.1 Sec13-like protein, partial [Populus tremula x Populus alba] ADC80689.1 Sec13-like protein, partial [Populus tremula x Populus alba] Length = 155 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 P G TSVSWAP TAPGALVGSGLL PVQKL SGG Sbjct: 35 PAGVTSVSWAPSTAPGALVGSGLLDPVQKLCSGG 68 >ADC80667.1 Sec13-like protein, partial [Bauhinia purpurea] Length = 155 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 107 PVGATSVSWAPVTAPGALVGSGLLVPVQKLVSGG 6 PVG TSVSWAP TAPGALVG+GLL PVQKL SGG Sbjct: 35 PVGITSVSWAPSTAPGALVGAGLLDPVQKLCSGG 68