BLASTX nr result
ID: Papaver32_contig00003024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver32_contig00003024 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020132533.1 60s ribosomal protein l16 [Diplodia corticola] OJ... 94 4e-21 EKG17306.1 Ribosomal protein L13 eukaryotic/archaeal [Macrophomi... 93 6e-21 OCK81291.1 ribosomal protein L13, partial [Lepidopterella palust... 90 3e-20 KKY21809.1 putative 60s ribosomal protein l16 [Diplodia seriata]... 91 4e-20 XP_013344677.1 hypothetical protein AUEXF2481DRAFT_79330 [Aureob... 91 4e-20 KEQ84278.1 ribosomal protein L13 [Aureobasidium pullulans EXF-15... 91 4e-20 XP_007778809.1 60S ribosomal protein L16 [Coniosporium apollinis... 91 6e-20 XP_003016160.1 hypothetical protein ARB_05557 [Trichophyton benh... 87 1e-19 XP_018388500.1 ribosomal protein L13 [Alternaria alternata] OAG2... 90 1e-19 XP_017996804.1 60S ribosomal protein L16 [Phialophora attae] KPI... 90 1e-19 XP_007802287.1 60S ribosomal protein L16 [Endocarpon pusillum Z0... 90 1e-19 XP_003844193.1 hypothetical protein LEMA_P018440.1 [Leptosphaeri... 88 2e-19 XP_001930606.1 60S ribosomal protein L16 [Pyrenophora tritici-re... 89 2e-19 XP_007583375.1 putative 60s ribosomal protein l16 protein [Neofu... 89 2e-19 XP_007684103.1 hypothetical protein COCMIDRAFT_84662 [Bipolaris ... 89 2e-19 KXL46394.1 hypothetical protein FE78DRAFT_146253 [Acidomyces ric... 89 3e-19 KFX88286.1 hypothetical protein V490_07740 [Pseudogymnoascus sp.... 88 5e-19 KNG48492.1 60s ribosomal protein l16 [Stemphylium lycopersici] 88 5e-19 OCL01562.1 ribosomal protein L13 [Glonium stellatum] 88 7e-19 XP_008712398.1 60S ribosomal protein L16 [Cyphellophora europaea... 87 9e-19 >XP_020132533.1 60s ribosomal protein l16 [Diplodia corticola] OJD36273.1 60s ribosomal protein l16 [Diplodia corticola] Length = 202 Score = 93.6 bits (231), Expect = 4e-21 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVK +AYYERK+AL+++L DA+KSA +D KVK +LA+YGY Sbjct: 143 LGHEFGWKYQDVVSRLEERRKVKSAAYYERKKALRRQLSDAQKSAKVDEKVKTQLAEYGY 202 >EKG17306.1 Ribosomal protein L13 eukaryotic/archaeal [Macrophomina phaseolina MS6] Length = 202 Score = 93.2 bits (230), Expect = 6e-21 Identities = 41/60 (68%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+AL++ L +A+K+A +D KVK +LA+YGY Sbjct: 143 LGHEFGWKYQDVVSRLEERRKVKGAAYYERKKALRRSLAEAQKTAKVDEKVKTQLAEYGY 202 >OCK81291.1 ribosomal protein L13, partial [Lepidopterella palustris CBS 459.81] Length = 154 Score = 90.1 bits (222), Expect = 3e-20 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+ +++L +A+K+A +DSKVK +LA YGY Sbjct: 95 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEAQKTAKVDSKVKTQLADYGY 154 >KKY21809.1 putative 60s ribosomal protein l16 [Diplodia seriata] OMP87139.1 60S ribosomal protein L16 [Diplodia seriata] Length = 202 Score = 90.9 bits (224), Expect = 4e-20 Identities = 40/60 (66%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVK +AYYERK+AL+++L DA+K+A +D KVK +LA++GY Sbjct: 143 LGHEFGWKYQDVVSRLEERRKVKSAAYYERKKALRRQLSDAQKTAKVDEKVKTQLAEFGY 202 >XP_013344677.1 hypothetical protein AUEXF2481DRAFT_79330 [Aureobasidium subglaciale EXF-2481] KEQ96222.1 hypothetical protein AUEXF2481DRAFT_79330 [Aureobasidium subglaciale EXF-2481] Length = 202 Score = 90.9 bits (224), Expect = 4e-20 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A ++ L +A+K+A +D KVK ELA YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAARRSLAEAQKTAKVDEKVKTELASYGY 202 >KEQ84278.1 ribosomal protein L13 [Aureobasidium pullulans EXF-150] OBW69513.1 Uncharacterized protein AUREO_004260 [Aureobasidium pullulans] Length = 202 Score = 90.9 bits (224), Expect = 4e-20 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A ++ L +A+K+A +D KVK ELA YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAARRSLAEAQKTAKVDDKVKTELASYGY 202 >XP_007778809.1 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218] EON63492.1 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218] Length = 202 Score = 90.5 bits (223), Expect = 6e-20 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A +++L +A+KSA +D K K +LA+YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAEAQKSASVDEKTKTQLAEYGY 202 >XP_003016160.1 hypothetical protein ARB_05557 [Trichophyton benhamiae CBS 112371] XP_003022512.1 hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] EFE35515.1 hypothetical protein ARB_05557 [Trichophyton benhamiae CBS 112371] EFE41894.1 hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] Length = 114 Score = 87.4 bits (215), Expect = 1e-19 Identities = 38/60 (63%), Positives = 51/60 (85%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 L E GWKY DVV +LEERRKVKG+AYYERK+A +++L+ A+++A +D+K KE+LAQYGY Sbjct: 55 LSHEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 114 >XP_018388500.1 ribosomal protein L13 [Alternaria alternata] OAG23079.1 ribosomal protein L13 [Alternaria alternata] Length = 202 Score = 89.7 bits (221), Expect = 1e-19 Identities = 40/60 (66%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A++++L +AKK+A +DSKV++EL GY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAVRRQLAEAKKTANVDSKVQQELTSLGY 202 >XP_017996804.1 60S ribosomal protein L16 [Phialophora attae] KPI36841.1 60S ribosomal protein L16 [Phialophora attae] Length = 202 Score = 89.7 bits (221), Expect = 1e-19 Identities = 39/60 (65%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 L E GWKY DVV +LEERRKVKG+A+YERK+A +++L +AKK+AP+D KVK++LA+YGY Sbjct: 143 LSHEVGWKYQDVVARLEERRKVKGAAFYERKKAARRQLAEAKKTAPVDQKVKDKLAEYGY 202 >XP_007802287.1 60S ribosomal protein L16 [Endocarpon pusillum Z07020] ERF72060.1 60S ribosomal protein L16 [Endocarpon pusillum Z07020] Length = 202 Score = 89.7 bits (221), Expect = 1e-19 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVK +AYYERK+A+++ L+ AKK A +D +K+ELA+YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKSAAYYERKKAMRRTLVTAKKEASVDENIKKELAKYGY 202 >XP_003844193.1 hypothetical protein LEMA_P018440.1 [Leptosphaeria maculans JN3] CBY00714.1 hypothetical protein LEMA_P018440.1 [Leptosphaeria maculans JN3] Length = 154 Score = 88.2 bits (217), Expect = 2e-19 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A++++L +AKK+A IDSK +E L GY Sbjct: 95 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAVRRQLAEAKKTASIDSKTQEHLTSLGY 154 >XP_001930606.1 60S ribosomal protein L16 [Pyrenophora tritici-repentis Pt-1C-BFP] XP_003296096.1 60S ribosomal protein L16 [Pyrenophora teres f. teres 0-1] EDU39711.1 60S ribosomal protein L16-B [Pyrenophora tritici-repentis Pt-1C-BFP] EFQ95806.1 hypothetical protein PTT_04845 [Pyrenophora teres f. teres 0-1] Length = 202 Score = 89.4 bits (220), Expect = 2e-19 Identities = 39/60 (65%), Positives = 51/60 (85%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+A+++++ +AKK+A +DSK +EEL GY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKAIRRQMAEAKKTATVDSKTQEELTSLGY 202 >XP_007583375.1 putative 60s ribosomal protein l16 protein [Neofusicoccum parvum UCRNP2] EOD49135.1 putative 60s ribosomal protein l16 protein [Neofusicoccum parvum UCRNP2] Length = 202 Score = 89.4 bits (220), Expect = 2e-19 Identities = 40/60 (66%), Positives = 52/60 (86%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+AL++ L +A+K+A ++ KVK +LA+YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKALRRSLGEAQKTAKVNEKVKTQLAEYGY 202 >XP_007684103.1 hypothetical protein COCMIDRAFT_84662 [Bipolaris oryzae ATCC 44560] XP_007703787.1 hypothetical protein COCSADRAFT_184241 [Bipolaris sorokiniana ND90Pr] XP_007710137.1 hypothetical protein COCCADRAFT_90506 [Bipolaris zeicola 26-R-13] XP_014083284.1 hypothetical protein COCC4DRAFT_187061 [Bipolaris maydis ATCC 48331] XP_014560590.1 hypothetical protein COCVIDRAFT_23212 [Bipolaris victoriae FI3] EMD60433.1 hypothetical protein COCSADRAFT_184241 [Bipolaris sorokiniana ND90Pr] EMD90413.1 hypothetical protein COCHEDRAFT_1225895 [Bipolaris maydis C5] ENI09375.1 hypothetical protein COCC4DRAFT_187061 [Bipolaris maydis ATCC 48331] EUC35533.1 hypothetical protein COCCADRAFT_90506 [Bipolaris zeicola 26-R-13] EUC49354.1 hypothetical protein COCMIDRAFT_84662 [Bipolaris oryzae ATCC 44560] EUN31043.1 hypothetical protein COCVIDRAFT_23212 [Bipolaris victoriae FI3] Length = 202 Score = 89.0 bits (219), Expect = 2e-19 Identities = 40/60 (66%), Positives = 51/60 (85%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+AL+++L +AKK+A +DSK +E+L GY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKKTANVDSKTQEQLTALGY 202 >KXL46394.1 hypothetical protein FE78DRAFT_146253 [Acidomyces richmondensis] KYG46184.1 hypothetical protein M433DRAFT_65722 [Acidomyces richmondensis BFW] Length = 202 Score = 88.6 bits (218), Expect = 3e-19 Identities = 41/60 (68%), Positives = 49/60 (81%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV++LEERRKVKG AYYERK+A +K L DAK +A ID+ K++L QYGY Sbjct: 143 LGHEFGWKYRDVVERLEERRKVKGKAYYERKKAARKMLGDAKANAKIDADTKKQLEQYGY 202 >KFX88286.1 hypothetical protein V490_07740 [Pseudogymnoascus sp. VKM F-3557] KFY02368.1 hypothetical protein O988_02196 [Pseudogymnoascus sp. VKM F-3808] KFY47939.1 hypothetical protein V495_01725 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY60119.1 hypothetical protein V497_03846 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] Length = 202 Score = 88.2 bits (217), Expect = 5e-19 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 L E GWKY DVV +LEERRKVKGSAYYERK+A +++L +A+KSA +DSK KE+LA +GY Sbjct: 143 LSHEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAEAQKSAKVDSKTKEQLASFGY 202 >KNG48492.1 60s ribosomal protein l16 [Stemphylium lycopersici] Length = 205 Score = 88.2 bits (217), Expect = 5e-19 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+AL+++L +AKK+A +DSK +EEL Y Sbjct: 146 LGHEFGWKYQDVVARLEERRKVKGTAYYERKKALRRQLAEAKKTANVDSKTQEELTSLAY 205 >OCL01562.1 ribosomal protein L13 [Glonium stellatum] Length = 202 Score = 87.8 bits (216), Expect = 7e-19 Identities = 38/60 (63%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 LG EFGWKY DVV +LEERRKVKG+AYYERK+ +++L +A+KSA +D + K +LA+YGY Sbjct: 143 LGHEFGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEAQKSATVDKETKSQLAEYGY 202 >XP_008712398.1 60S ribosomal protein L16 [Cyphellophora europaea CBS 101466] ETN45670.1 60S ribosomal protein L16 [Cyphellophora europaea CBS 101466] Length = 202 Score = 87.4 bits (215), Expect = 9e-19 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = -1 Query: 419 LGREFGWKYSDVVDKLEERRKVKGSAYYERKRALQKKLIDAKKSAPIDSKVKEELAQYGY 240 L E GWKY DVV +LEERRKVKG+AYYERK+A +++L +AKK+A +D KVK +LA+YGY Sbjct: 143 LSHEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAEAKKTASVDDKVKSKLAEYGY 202