BLASTX nr result
ID: Papaver31_contig00054784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00054784 (507 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001189606.1| fatty acid binding protein 2 [Arabidopsis th... 64 3e-08 gb|AAC14521.1| hypothetical protein [Arabidopsis thaliana] 64 3e-08 >ref|NP_001189606.1| fatty acid binding protein 2 [Arabidopsis thaliana] gi|330252728|gb|AEC07822.1| fatty acid binding protein 2 [Arabidopsis thaliana] Length = 373 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = -1 Query: 390 EKPLRARLLKGTTIDVRRTMDGQLITRIDGKYIGAVPSKDLCSKKFLLFL 241 EK LRARL+KGT ID RRT DGQLIT I G IGAV SKDLC F +++ Sbjct: 300 EKSLRARLVKGTIIDFRRTEDGQLITEIGGNLIGAVRSKDLCRAFFGMYI 349 >gb|AAC14521.1| hypothetical protein [Arabidopsis thaliana] Length = 107 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -1 Query: 390 EKPLRARLLKGTTIDVRRTMDGQLITRIDGKYIGAVPSKDLCS 262 EK LRARL+KGT ID RRT DGQLIT I G IGAV SKDLCS Sbjct: 65 EKSLRARLVKGTIIDFRRTEDGQLITEIGGNLIGAVRSKDLCS 107