BLASTX nr result
ID: Papaver31_contig00054631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00054631 (476 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244950.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_010244950.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Nelumbo nucifera] Length = 909 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 9/80 (11%) Frame = -2 Query: 283 SLFMQNMFIIWQRLVNWN--------HGCGRKTL-MFLEMKLCGIDPNDMVLVGFVYAFN 131 ++F N+ I + ++ WN HGCGR+ L F EMK+ PN++ +G + A + Sbjct: 719 TIFRNNVDI--RDVITWNSMICGYAYHGCGREALDTFTEMKVSEEKPNEITFIGVLCACS 776 Query: 130 HAGVVSEAEAQLSSASTDHG 71 HAG++SEA+ Q SS DHG Sbjct: 777 HAGLISEAQDQFSSMYQDHG 796