BLASTX nr result
ID: Papaver31_contig00053964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00053964 (714 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343488.1| PREDICTED: pentatricopeptide repeat-containi... 157 5e-36 ref|XP_008236588.1| PREDICTED: pentatricopeptide repeat-containi... 155 3e-35 ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prun... 155 3e-35 ref|XP_010313040.1| PREDICTED: pentatricopeptide repeat-containi... 154 4e-35 ref|XP_010647748.1| PREDICTED: pentatricopeptide repeat-containi... 154 7e-35 emb|CBI32403.3| unnamed protein product [Vitis vinifera] 154 7e-35 emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] 154 7e-35 ref|XP_011461481.1| PREDICTED: pentatricopeptide repeat-containi... 153 9e-35 ref|XP_011461479.1| PREDICTED: pentatricopeptide repeat-containi... 153 9e-35 ref|XP_007146392.1| hypothetical protein PHAVU_006G036400g [Phas... 153 1e-34 ref|XP_012480229.1| PREDICTED: pentatricopeptide repeat-containi... 152 2e-34 ref|XP_008373135.1| PREDICTED: pentatricopeptide repeat-containi... 152 2e-34 gb|KRG98629.1| hypothetical protein GLYMA_18G085900 [Glycine max] 151 4e-34 ref|XP_010647985.1| PREDICTED: pentatricopeptide repeat-containi... 151 4e-34 ref|XP_009764429.1| PREDICTED: pentatricopeptide repeat-containi... 151 4e-34 ref|XP_009764410.1| PREDICTED: pentatricopeptide repeat-containi... 151 4e-34 ref|XP_009591801.1| PREDICTED: pentatricopeptide repeat-containi... 151 4e-34 emb|CBI25078.3| unnamed protein product [Vitis vinifera] 151 4e-34 ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfam... 151 4e-34 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 151 4e-34 >ref|XP_006343488.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Solanum tuberosum] gi|565353132|ref|XP_006343489.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Solanum tuberosum] gi|565353134|ref|XP_006343490.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Solanum tuberosum] gi|565353136|ref|XP_006343491.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Solanum tuberosum] Length = 831 Score = 157 bits (398), Expect = 5e-36 Identities = 70/79 (88%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKE ILTSHSERLAIAYGI+NTPPK P+RI+KNLRVCGDCHN TKLISKITER+IIVR Sbjct: 753 DDEKEQILTSHSERLAIAYGILNTPPKNPLRIYKNLRVCGDCHNVTKLISKITEREIIVR 812 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF+NG CSCGDYW Sbjct: 813 DSNRFHHFKNGVCSCGDYW 831 >ref|XP_008236588.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Prunus mume] Length = 820 Score = 155 bits (391), Expect = 3e-35 Identities = 69/79 (87%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKEHIL SHSERLAIA+G+I+TPPKTPIRIFKNLRVCGDCHNATK IS ITER+IIVR Sbjct: 742 DDEKEHILNSHSERLAIAFGLISTPPKTPIRIFKNLRVCGDCHNATKFISVITEREIIVR 801 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 802 DSNRFHHFKDGACSCGDYW 820 >ref|XP_007198996.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] gi|462394396|gb|EMJ00195.1| hypothetical protein PRUPE_ppa002176mg [Prunus persica] Length = 705 Score = 155 bits (391), Expect = 3e-35 Identities = 69/79 (87%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKEHIL SHSERLAIA+G+I+TPPKTPIRIFKNLRVCGDCHNATK IS ITER+IIVR Sbjct: 627 DDEKEHILNSHSERLAIAFGLISTPPKTPIRIFKNLRVCGDCHNATKFISVITEREIIVR 686 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 687 DSNRFHHFKDGACSCGDYW 705 >ref|XP_010313040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Solanum lycopersicum] gi|723743764|ref|XP_010313041.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Solanum lycopersicum] gi|723743767|ref|XP_010313042.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Solanum lycopersicum] gi|723743770|ref|XP_010313043.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Solanum lycopersicum] Length = 831 Score = 154 bits (390), Expect = 4e-35 Identities = 68/79 (86%), Positives = 76/79 (96%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKE ILTSHSERLAIAYGI++TPPK+P+RI+KNLRVCGDCHN TKLISKITER+IIVR Sbjct: 753 EDEKEQILTSHSERLAIAYGILSTPPKSPLRIYKNLRVCGDCHNVTKLISKITEREIIVR 812 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF+NG CSCGDYW Sbjct: 813 DSNRFHHFKNGVCSCGDYW 831 >ref|XP_010647748.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Vitis vinifera] Length = 819 Score = 154 bits (388), Expect = 7e-35 Identities = 67/79 (84%), Positives = 77/79 (97%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHILTSHSERLAIA+GII+TPPK+PIRIFKNLRVCGDCHNATK IS+IT+R+I+VR Sbjct: 741 EDEKEHILTSHSERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVR 800 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 801 DSNRFHHFKDGICSCGDYW 819 >emb|CBI32403.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 154 bits (388), Expect = 7e-35 Identities = 67/79 (84%), Positives = 77/79 (97%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHILTSHSERLAIA+GII+TPPK+PIRIFKNLRVCGDCHNATK IS+IT+R+I+VR Sbjct: 580 EDEKEHILTSHSERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVR 639 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 640 DSNRFHHFKDGICSCGDYW 658 >emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] Length = 891 Score = 154 bits (388), Expect = 7e-35 Identities = 67/79 (84%), Positives = 77/79 (97%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHILTSHSERLAIA+GII+TPPK+PIRIFKNLRVCGDCHNATK IS+IT+R+I+VR Sbjct: 813 EDEKEHILTSHSERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVR 872 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 873 DSNRFHHFKDGICSCGDYW 891 >ref|XP_011461481.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Fragaria vesca subsp. vesca] gi|764562547|ref|XP_011461482.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Fragaria vesca subsp. vesca] gi|764562550|ref|XP_011461483.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Fragaria vesca subsp. vesca] gi|764562554|ref|XP_011461484.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Fragaria vesca subsp. vesca] Length = 819 Score = 153 bits (387), Expect = 9e-35 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKEHIL SHSERLAIA+GII+TPPKTPIRIFKNLRVCGDCH TKLIS ITER+IIVR Sbjct: 741 DDEKEHILNSHSERLAIAFGIISTPPKTPIRIFKNLRVCGDCHTVTKLISVITEREIIVR 800 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 801 DSNRFHHFKDGTCSCGDYW 819 >ref|XP_011461479.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Fragaria vesca subsp. vesca] gi|764562539|ref|XP_011461480.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Fragaria vesca subsp. vesca] Length = 867 Score = 153 bits (387), Expect = 9e-35 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKEHIL SHSERLAIA+GII+TPPKTPIRIFKNLRVCGDCH TKLIS ITER+IIVR Sbjct: 789 DDEKEHILNSHSERLAIAFGIISTPPKTPIRIFKNLRVCGDCHTVTKLISVITEREIIVR 848 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 849 DSNRFHHFKDGTCSCGDYW 867 >ref|XP_007146392.1| hypothetical protein PHAVU_006G036400g [Phaseolus vulgaris] gi|561019615|gb|ESW18386.1| hypothetical protein PHAVU_006G036400g [Phaseolus vulgaris] Length = 816 Score = 153 bits (386), Expect = 1e-34 Identities = 68/79 (86%), Positives = 76/79 (96%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKE ILTSHSER+AIA+G+I+TPPK+PIRIFKNLRVCGDCHNATK ISKITERDIIVR Sbjct: 738 EDEKEQILTSHSERVAIAFGLISTPPKSPIRIFKNLRVCGDCHNATKYISKITERDIIVR 797 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 798 DSNRFHHFKDGGCSCGDYW 816 >ref|XP_012480229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Gossypium raimondii] gi|763765115|gb|KJB32369.1| hypothetical protein B456_005G237500 [Gossypium raimondii] Length = 816 Score = 152 bits (385), Expect = 2e-34 Identities = 69/79 (87%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHIL SHSERLAIA+GII+TPPKTPIRIFKNLRVCGDCHNATK ISKITER+IIVR Sbjct: 738 EDEKEHILMSHSERLAIAFGIISTPPKTPIRIFKNLRVCGDCHNATKYISKITEREIIVR 797 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSC DYW Sbjct: 798 DSNRFHHFKDGVCSCRDYW 816 >ref|XP_008373135.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Malus domestica] Length = 820 Score = 152 bits (385), Expect = 2e-34 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKEHIL SHSERLAIA+GII+T PKTPIRIFKNLRVCGDCHNATK IS ITER+IIVR Sbjct: 742 DDEKEHILNSHSERLAIAFGIISTAPKTPIRIFKNLRVCGDCHNATKFISVITEREIIVR 801 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 802 DSNRFHHFKDGTCSCGDYW 820 >gb|KRG98629.1| hypothetical protein GLYMA_18G085900 [Glycine max] Length = 787 Score = 151 bits (382), Expect = 4e-34 Identities = 68/79 (86%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKE ILTSHSERLAI +GII+TPPK+PIRIFKNLRVCGDCHNATK ISKITER+IIVR Sbjct: 709 EDEKEEILTSHSERLAIVFGIISTPPKSPIRIFKNLRVCGDCHNATKYISKITEREIIVR 768 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 769 DSNRFHHFKDGICSCGDYW 787 >ref|XP_010647985.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 819 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHILTSHSERLAIA+GII+TPPK+ IRIFKNLRVCGDCHNATK IS+ITER+I+VR Sbjct: 741 EDEKEHILTSHSERLAIAFGIISTPPKSAIRIFKNLRVCGDCHNATKFISRITEREIVVR 800 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DS RFHHF+NG CSCGDYW Sbjct: 801 DSKRFHHFKNGICSCGDYW 819 >ref|XP_009764429.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X3 [Nicotiana sylvestris] Length = 834 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKE ILTSHSERLAIAYGI+NTP ++P+RI+KNLRVCGDCHN TKLISKITER+IIVR Sbjct: 756 DDEKEQILTSHSERLAIAYGILNTPHRSPLRIYKNLRVCGDCHNVTKLISKITEREIIVR 815 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 816 DSNRFHHFKDGVCSCGDYW 834 >ref|XP_009764410.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536141|ref|XP_009764411.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536144|ref|XP_009764413.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536147|ref|XP_009764414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536150|ref|XP_009764415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536153|ref|XP_009764416.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536157|ref|XP_009764417.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536160|ref|XP_009764418.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536163|ref|XP_009764419.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536166|ref|XP_009764420.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536170|ref|XP_009764421.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536173|ref|XP_009764422.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536176|ref|XP_009764423.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536179|ref|XP_009764424.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536182|ref|XP_009764425.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] gi|698536185|ref|XP_009764426.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X2 [Nicotiana sylvestris] gi|698536188|ref|XP_009764427.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990 isoform X1 [Nicotiana sylvestris] Length = 852 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKE ILTSHSERLAIAYGI+NTP ++P+RI+KNLRVCGDCHN TKLISKITER+IIVR Sbjct: 774 DDEKEQILTSHSERLAIAYGILNTPHRSPLRIYKNLRVCGDCHNVTKLISKITEREIIVR 833 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 834 DSNRFHHFKDGVCSCGDYW 852 >ref|XP_009591801.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like, partial [Nicotiana tomentosiformis] Length = 842 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 DDEKE ILTSHSERLAIAYGI+NTP ++P+RI+KNLRVCGDCHN TKLISKITER+IIVR Sbjct: 764 DDEKEQILTSHSERLAIAYGILNTPHRSPLRIYKNLRVCGDCHNVTKLISKITEREIIVR 823 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 824 DSNRFHHFKDGVCSCGDYW 842 >emb|CBI25078.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHILTSHSERLAIA+GII+TPPK+ IRIFKNLRVCGDCHNATK IS+ITER+I+VR Sbjct: 416 EDEKEHILTSHSERLAIAFGIISTPPKSAIRIFKNLRVCGDCHNATKFISRITEREIVVR 475 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DS RFHHF+NG CSCGDYW Sbjct: 476 DSKRFHHFKNGICSCGDYW 494 >ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706373|gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 820 Score = 151 bits (382), Expect = 4e-34 Identities = 67/79 (84%), Positives = 76/79 (96%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKEHIL SHSERLAIAYGII++PPK+PIRIFKNLRVCGDCHNATK IS+IT+R+IIVR Sbjct: 742 EDEKEHILMSHSERLAIAYGIISSPPKSPIRIFKNLRVCGDCHNATKFISQITDREIIVR 801 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 802 DSNRFHHFKDGICSCGDYW 820 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 151 bits (382), Expect = 4e-34 Identities = 68/79 (86%), Positives = 75/79 (94%) Frame = -2 Query: 713 DDEKEHILTSHSERLAIAYGIINTPPKTPIRIFKNLRVCGDCHNATKLISKITERDIIVR 534 +DEKE ILTSHSERLAI +GII+TPPK+PIRIFKNLRVCGDCHNATK ISKITER+IIVR Sbjct: 746 EDEKEEILTSHSERLAIVFGIISTPPKSPIRIFKNLRVCGDCHNATKYISKITEREIIVR 805 Query: 533 DSNRFHHFRNGKCSCGDYW 477 DSNRFHHF++G CSCGDYW Sbjct: 806 DSNRFHHFKDGICSCGDYW 824