BLASTX nr result
ID: Papaver31_contig00052778
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00052778 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase ac... 82 2e-15 ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase ac... 81 4e-15 ref|XP_006576561.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-14 ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase ac... 79 2e-14 gb|KRH66056.1| hypothetical protein GLYMA_03G080300 [Glycine max] 79 2e-14 gb|KRH66059.1| hypothetical protein GLYMA_03G080300 [Glycine max] 79 2e-14 gb|KRH66058.1| hypothetical protein GLYMA_03G080300 [Glycine max] 79 2e-14 gb|KHN39625.1| Mitochondrial ubiquitin ligase activator of nfkb ... 78 3e-14 ref|XP_007135436.1| hypothetical protein PHAVU_010G129300g [Phas... 77 4e-14 ref|XP_010261888.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 7e-14 gb|KOM57062.1| hypothetical protein LR48_Vigan11g009400 [Vigna a... 77 7e-14 ref|XP_014515114.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 3e-13 ref|XP_010086805.1| Mitochondrial ubiquitin ligase activator of ... 74 6e-13 ref|XP_007024628.1| E3 Ubiquitin ligase family protein isoform 1... 73 6e-13 ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus ... 72 7e-13 ref|XP_012456410.1| PREDICTED: mitochondrial ubiquitin ligase ac... 70 1e-12 gb|KJB70125.1| hypothetical protein B456_011G059000 [Gossypium r... 70 1e-12 ref|XP_009781223.1| PREDICTED: mitochondrial ubiquitin ligase ac... 69 8e-12 ref|XP_010685312.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 9e-12 ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase ac... 76 9e-12 >ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] gi|947049972|gb|KRG99500.1| hypothetical protein GLYMA_18G149800 [Glycine max] Length = 387 Score = 81.6 bits (200), Expect(2) = 2e-15 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV LL D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 156 KVPFLLTDVGRRPNAEYVVVNMDGSRHPLPLTTVYHKLQPITASPYTFLQALFGHEYPV 214 Score = 26.9 bits (58), Expect(2) = 2e-15 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 214 VGLLDEEKILPLGKDITAV 232 >ref|XP_003547746.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like [Glycine max] gi|947056787|gb|KRH06193.1| hypothetical protein GLYMA_16G008300 [Glycine max] Length = 383 Score = 80.9 bits (198), Expect(2) = 4e-15 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 152 KVPFVLIDVGRRPNAEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 210 Score = 26.9 bits (58), Expect(2) = 4e-15 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 210 VGLLDEEKILPLGKDITAV 228 >ref|XP_006576561.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X2 [Glycine max] Length = 394 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 157 KVPFVLIDVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like isoform X1 [Glycine max] gi|947117808|gb|KRH66057.1| hypothetical protein GLYMA_03G080300 [Glycine max] Length = 388 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 157 KVPFVLIDVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >gb|KRH66056.1| hypothetical protein GLYMA_03G080300 [Glycine max] Length = 348 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 157 KVPFVLIDVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >gb|KRH66059.1| hypothetical protein GLYMA_03G080300 [Glycine max] Length = 259 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 157 KVPFVLIDVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >gb|KRH66058.1| hypothetical protein GLYMA_03G080300 [Glycine max] Length = 256 Score = 78.6 bits (192), Expect(2) = 2e-14 Identities = 36/59 (61%), Positives = 45/59 (76%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 157 KVPFVLIDVGRWPNAEYVVVNMDGSRHPLPLSTVYHKLQPITASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 2e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKNITAV 233 >gb|KHN39625.1| Mitochondrial ubiquitin ligase activator of nfkb 1, partial [Glycine soja] Length = 320 Score = 77.8 bits (190), Expect(2) = 3e-14 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR ++Y+ VNMDGS+H LPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 89 KVPFVLIDVGRRPNAEYVVVNMDGSRHSLPLTTVYHKLQPINASPYTFLQALFGHEYPV 147 Score = 26.9 bits (58), Expect(2) = 3e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 147 VGLLDEEKILPLGKDITAV 165 >ref|XP_007135436.1| hypothetical protein PHAVU_010G129300g [Phaseolus vulgaris] gi|561008481|gb|ESW07430.1| hypothetical protein PHAVU_010G129300g [Phaseolus vulgaris] Length = 387 Score = 77.4 bits (189), Expect(2) = 4e-14 Identities = 35/59 (59%), Positives = 44/59 (74%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+G ++Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 156 KVPFVLIDVGWRPSTEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 214 Score = 26.9 bits (58), Expect(2) = 4e-14 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G ++AV Sbjct: 214 VGLLDEEKILPVGKDVTAV 232 >ref|XP_010261888.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nelumbo nucifera] Length = 391 Score = 75.9 bits (185), Expect(2) = 7e-14 Identities = 36/58 (62%), Positives = 45/58 (77%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 V +L + G+ SDY+ VN+DGS+HPLPLVTV H+LQPVQ SP TF+QA+ GH YPV Sbjct: 163 VPFILVEGGQWPHSDYVVVNLDGSRHPLPLVTVYHQLQPVQASPYTFLQALFGHHYPV 220 Score = 27.7 bits (60), Expect(2) = 7e-14 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G +I+AV Sbjct: 220 VGLLDEEKILPLGKEITAV 238 >gb|KOM57062.1| hypothetical protein LR48_Vigan11g009400 [Vigna angularis] Length = 388 Score = 76.6 bits (187), Expect(2) = 7e-14 Identities = 36/60 (60%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = -3 Query: 385 KVSVLLCDIGREVRS-DYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR+ + +Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 156 KVPFVLIDVGRQPSTPEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 215 Score = 26.9 bits (58), Expect(2) = 7e-14 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGLLDEEKILPLGKDITAV 233 >ref|XP_014515114.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A [Vigna radiata var. radiata] Length = 389 Score = 75.9 bits (185), Expect(2) = 3e-13 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 385 KVSVLLCDIGREVRS-DYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L D+GR + +Y+ VNMDGS+HPLPL TV HKLQP+ SP TF+QA+ GH YPV Sbjct: 156 KVPFVLIDVGRRPSTPEYVVVNMDGSRHPLPLTTVYHKLQPINASPYTFLQALFGHEYPV 215 Score = 25.4 bits (54), Expect(2) = 3e-13 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+ V Sbjct: 215 VGLLDEEKILPLGKDITVV 233 >ref|XP_010086805.1| Mitochondrial ubiquitin ligase activator of nfkb 1 [Morus notabilis] gi|587832984|gb|EXB23815.1| Mitochondrial ubiquitin ligase activator of nfkb 1 [Morus notabilis] Length = 393 Score = 73.6 bits (179), Expect(2) = 6e-13 Identities = 34/58 (58%), Positives = 44/58 (75%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 VS +L + G+ + D++ VNMDGS+HPLPL TV H+LQPV SP TF+QA+ GH YPV Sbjct: 160 VSFILVEAGKWPQMDFVVVNMDGSRHPLPLTTVYHQLQPVNPSPYTFLQALFGHEYPV 217 Score = 26.9 bits (58), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 217 VGLLDEEKILPLGKDITAV 235 >ref|XP_007024628.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] gi|508779994|gb|EOY27250.1| E3 Ubiquitin ligase family protein isoform 1 [Theobroma cacao] Length = 386 Score = 72.8 bits (177), Expect(2) = 6e-13 Identities = 34/59 (57%), Positives = 44/59 (74%) Frame = -3 Query: 385 KVSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 KV +L + G+ +SD + VNMDGS+HPLPL TV H+LQP+ SP TF+QA+ GH YPV Sbjct: 153 KVPFILVEGGQWPQSDCVIVNMDGSRHPLPLTTVYHQLQPINASPYTFLQALFGHEYPV 211 Score = 27.7 bits (60), Expect(2) = 6e-13 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G +I+AV Sbjct: 211 VGLLDEEKILPLGKEITAV 229 >ref|XP_002521326.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223539404|gb|EEF40994.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 387 Score = 72.4 bits (176), Expect(2) = 7e-13 Identities = 33/58 (56%), Positives = 43/58 (74%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 V +L + GR +SDY+ VN+DGS+HPLPL TV H+LQP+ SP TF+QA G+ YPV Sbjct: 154 VPFVLVEAGRWPQSDYVIVNLDGSRHPLPLTTVYHQLQPIDASPYTFLQAFFGYEYPV 211 Score = 27.7 bits (60), Expect(2) = 7e-13 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G +I+AV Sbjct: 211 VGLLDEEKILPLGKEINAV 229 >ref|XP_012456410.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Gossypium raimondii] gi|763803185|gb|KJB70123.1| hypothetical protein B456_011G059000 [Gossypium raimondii] Length = 386 Score = 70.1 bits (170), Expect(2) = 1e-12 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 V +L + G+ +SD++ VNM+GSKHPLPL TV H+L P+ SP TF+QA+ GH YPV Sbjct: 154 VPFILVEGGQWPQSDFVIVNMNGSKHPLPLTTVYHQLHPINASPYTFLQALFGHEYPV 211 Score = 29.3 bits (64), Expect(2) = 1e-12 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G +ISAV Sbjct: 211 VGLLDEEKILPVGKEISAV 229 >gb|KJB70125.1| hypothetical protein B456_011G059000 [Gossypium raimondii] Length = 296 Score = 70.1 bits (170), Expect(2) = 1e-12 Identities = 32/58 (55%), Positives = 43/58 (74%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 V +L + G+ +SD++ VNM+GSKHPLPL TV H+L P+ SP TF+QA+ GH YPV Sbjct: 154 VPFILVEGGQWPQSDFVIVNMNGSKHPLPLTTVYHQLHPINASPYTFLQALFGHEYPV 211 Score = 29.3 bits (64), Expect(2) = 1e-12 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G +ISAV Sbjct: 211 VGLLDEEKILPVGKEISAV 229 >ref|XP_009781223.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nicotiana sylvestris] Length = 391 Score = 69.3 bits (168), Expect(2) = 8e-12 Identities = 32/58 (55%), Positives = 42/58 (72%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPV 209 V ++ + GR + +Y+ VNMD S+HPLPLVTV H LQPV +P TF+QA+ GH YPV Sbjct: 158 VPFVIVEAGRWPQPEYVNVNMDSSRHPLPLVTVYHHLQPVNATPLTFLQALFGHPYPV 215 Score = 27.3 bits (59), Expect(2) = 8e-12 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 90 VGPLDEEKVLSIGTQISAV 34 VG LDEEK+L +G I+AV Sbjct: 215 VGVLDEEKILPLGKDITAV 233 >ref|XP_010685312.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Beta vulgaris subsp. vulgaris] gi|870852950|gb|KMT04831.1| hypothetical protein BVRB_7g170020 [Beta vulgaris subsp. vulgaris] Length = 396 Score = 76.3 bits (186), Expect = 9e-12 Identities = 45/97 (46%), Positives = 61/97 (62%), Gaps = 1/97 (1%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPVSF 203 V +L D ++ SDY+ V++DGSKHPLPL TV H +QP+Q SP TF+QA+ GH YPV Sbjct: 158 VPFVLVDGRQQPHSDYVLVDLDGSKHPLPLTTVYHNMQPIQASPYTFLQALLGHEYPVGV 217 Query: 202 GNDSFA*AVDWLHLGKLWSFVGT-FSRHSLGVFSFVS 95 ++ L LGK + VGT FS++ G+F S Sbjct: 218 VDEE-----KILPLGKEVTAVGTCFSKN--GIFEIKS 247 >ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 76.3 bits (186), Expect = 9e-12 Identities = 43/85 (50%), Positives = 54/85 (63%) Frame = -3 Query: 382 VSVLLCDIGREVRSDYLFVNMDGSKHPLPLVTV*HKLQPVQLSPCTFIQAVSGHVYPVSF 203 V +L + GR +SDY+ VNMDGS+HPLPL TV H+LQPV SP TF+QA+ GH YPV Sbjct: 159 VPFILVEGGRWPQSDYVIVNMDGSRHPLPLTTVYHQLQPVNASPYTFLQALFGHDYPVGL 218 Query: 202 GNDSFA*AVDWLHLGKLWSFVGTFS 128 ++ L LGK + VG S Sbjct: 219 LDEE-----KLLPLGKEITAVGICS 238