BLASTX nr result
ID: Papaver31_contig00052657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00052657 (690 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006389287.1| hypothetical protein POPTR_0031s00450g, part... 58 6e-06 ref|XP_008222927.1| PREDICTED: putative disease resistance prote... 57 8e-06 >ref|XP_006389287.1| hypothetical protein POPTR_0031s00450g, partial [Populus trichocarpa] gi|550312039|gb|ERP48201.1| hypothetical protein POPTR_0031s00450g, partial [Populus trichocarpa] Length = 954 Score = 57.8 bits (138), Expect = 6e-06 Identities = 41/93 (44%), Positives = 52/93 (55%), Gaps = 4/93 (4%) Frame = -3 Query: 682 SAEATTTSSFPSLVRLSFSNMRNLETWVTPPPPRN-CFPILEILCIKGCHGLRSVPDLRL 506 S+ +T FP+L LS M LE W+ P + FP LE L I+ C LRS+P ++ Sbjct: 751 SSSGSTEVLFPALKELSLLGMDGLEEWMVPCGEGDQVFPCLEKLSIEWCGKLRSIPSVQH 810 Query: 505 LTSLRKLDIVGCNKLAESIPYD---LKKSLSFL 416 T+L KLDI GC +L SIP D LK SL L Sbjct: 811 CTTLVKLDIDGCLELI-SIPGDFQELKYSLKIL 842 >ref|XP_008222927.1| PREDICTED: putative disease resistance protein RGA1 [Prunus mume] Length = 1205 Score = 57.4 bits (137), Expect = 8e-06 Identities = 29/65 (44%), Positives = 42/65 (64%) Frame = -3 Query: 655 FPSLVRLSFSNMRNLETWVTPPPPRNCFPILEILCIKGCHGLRSVPDLRLLTSLRKLDIV 476 FPSL++L+ N LE+ V+ P ++E+L IKGC GL+S+P+L L SL KL+I Sbjct: 944 FPSLLKLTIKNCERLESLVSSGP----VSVVELLTIKGCSGLQSIPNLNLFPSLLKLNIK 999 Query: 475 GCNKL 461 C +L Sbjct: 1000 NCERL 1004