BLASTX nr result
ID: Papaver31_contig00052559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00052559 (500 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citr... 82 2e-13 ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Popu... 79 2e-12 ref|XP_012084286.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 ref|XP_012084287.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 emb|CBI28722.3| unnamed protein product [Vitis vinifera] 78 3e-12 ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containi... 78 3e-12 gb|KNA23768.1| hypothetical protein SOVF_022320 [Spinacia oleracea] 77 4e-12 ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_004299875.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_011032661.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 ref|XP_012081319.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_012081318.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_012081315.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily p... 76 9e-12 ref|XP_006355028.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_010086604.1| hypothetical protein L484_002429 [Morus nota... 75 1e-11 ref|XP_004237184.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_010269003.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_009775482.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 >ref|XP_006444032.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] gi|568852030|ref|XP_006479684.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Citrus sinensis] gi|568852032|ref|XP_006479685.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Citrus sinensis] gi|557546294|gb|ESR57272.1| hypothetical protein CICLE_v10018932mg [Citrus clementina] gi|641849797|gb|KDO68671.1| hypothetical protein CISIN_1g003946mg [Citrus sinensis] Length = 784 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME GKMFIDKYKYRTLFL Y KTL+K KTP F +EA +K+R+AAL FK+WLGL Sbjct: 730 MMEEGKMFIDKYKYRTLFLKYHKTLYKG-KTPKFQTEAQLKKREAALGFKKWLGL 783 >ref|XP_002306785.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] gi|550339593|gb|EEE93781.2| hypothetical protein POPTR_0005s23410g [Populus trichocarpa] Length = 787 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME GKMFIDKYKYRTL+L Y KTL+K KTP +E+ VK+R+AAL FK+WLGL Sbjct: 733 MMEKGKMFIDKYKYRTLYLKYHKTLYKG-KTPKIQTESLVKKREAALTFKKWLGL 786 >ref|XP_012084286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] Length = 798 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +KRR+A L FK+W+GL Sbjct: 744 MMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKRREAVLSFKKWVGL 797 >ref|XP_012084287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] gi|802707297|ref|XP_012084288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] gi|643715933|gb|KDP27748.1| hypothetical protein JCGZ_19777 [Jatropha curcas] Length = 781 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +KRR+A L FK+W+GL Sbjct: 727 MMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKRREAVLSFKKWVGL 780 >emb|CBI28722.3| unnamed protein product [Vitis vinifera] Length = 1361 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME GKMFIDKYKYRTLFL Y KTL+K+ K P +EA +RRDAAL FK+W+GL Sbjct: 1307 MMERGKMFIDKYKYRTLFLKYHKTLYKS-KPPKVQTEAQFRRRDAALTFKKWVGL 1360 >ref|XP_003632339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] gi|731394889|ref|XP_010651991.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Vitis vinifera] Length = 784 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME GKMFIDKYKYRTLFL Y KTL+K+ K P +EA +RRDAAL FK+W+GL Sbjct: 730 MMERGKMFIDKYKYRTLFLKYHKTLYKS-KPPKVQTEAQFRRRDAALTFKKWVGL 783 >gb|KNA23768.1| hypothetical protein SOVF_022320 [Spinacia oleracea] Length = 772 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MFIDKY+YRTLFL Y KTL+K KTP F +EA K+RDA L FK+W+GL Sbjct: 718 MMEKGNMFIDKYRYRTLFLKYHKTLYKG-KTPKFETEAQSKKRDATLAFKKWVGL 771 >ref|XP_012473539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Gossypium raimondii] gi|763755260|gb|KJB22591.1| hypothetical protein B456_004G055800 [Gossypium raimondii] Length = 778 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MFIDKYKYRTL+L Y KTL+K KTP F +E+ +K+R+AAL FK+W+GL Sbjct: 724 MMEKGNMFIDKYKYRTLYLKYHKTLYKG-KTPKFQTESQLKKREAALSFKKWIGL 777 >ref|XP_004299875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Fragaria vesca subsp. vesca] Length = 795 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME KMFIDKYKYRTLFL Y KTLHK K P F +E+ +K+R+AAL FK W+G+ Sbjct: 741 MMEKAKMFIDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAALAFKNWIGV 794 >ref|XP_011032661.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867180|ref|XP_011032662.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867184|ref|XP_011032664.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] gi|743867188|ref|XP_011032665.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Populus euphratica] Length = 787 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/55 (67%), Positives = 44/55 (80%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME GKMFIDKYKYRTL+L Y KTL+K KTP +E+ VK+R+AAL K+WLGL Sbjct: 733 MMEKGKMFIDKYKYRTLYLKYHKTLYKG-KTPKIQTESQVKKREAALTLKKWLGL 786 >ref|XP_012081319.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X3 [Jatropha curcas] Length = 683 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L FK+W+GL Sbjct: 630 MMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSFKKWVGL 683 >ref|XP_012081318.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Jatropha curcas] Length = 689 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L FK+W+GL Sbjct: 636 MMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSFKKWVGL 689 >ref|XP_012081315.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|802667142|ref|XP_012081316.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|802667149|ref|XP_012081317.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Jatropha curcas] gi|643718957|gb|KDP30006.1| hypothetical protein JCGZ_18578 [Jatropha curcas] Length = 780 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTLHK K P F +E+ +K+R+A L FK+W+GL Sbjct: 727 MMEKGNMFVDKYKYRTLFLKYHKTLHKG-KAPKFQTESQLKKREAVLSFKKWVGL 780 >ref|XP_007050539.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508702800|gb|EOX94696.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 780 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 +ME G MFIDKYKYRTLFL Y KTL+K K P F +EA +K+R+AAL FK+W+GL Sbjct: 726 VMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLKKREAALTFKKWVGL 779 >ref|XP_006355028.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565377103|ref|XP_006355029.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 776 Score = 75.9 bits (185), Expect = 1e-11 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MFIDKYKYRTLFL Y KTL+K K P F SE+ +K+R+AAL FK W GL Sbjct: 722 MMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQSESQMKKREAALNFKRWAGL 775 >ref|XP_010086604.1| hypothetical protein L484_002429 [Morus notabilis] gi|587831217|gb|EXB22115.1| hypothetical protein L484_002429 [Morus notabilis] Length = 739 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MF+DKYKYRTLFL Y KTL+K K P F +EA + +R+AAL FK+W+GL Sbjct: 685 MMEKGNMFVDKYKYRTLFLKYHKTLYKG-KAPKFQTEAQLSKREAALAFKKWVGL 738 >ref|XP_004237184.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Solanum lycopersicum] Length = 776 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MFIDKYKYRTLFL Y KTL+K K P F SE +K+R+AAL FK W GL Sbjct: 722 MMEKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQSETQMKKREAALNFKRWAGL 775 >ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] gi|747075306|ref|XP_011084682.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME G MFIDKYKYR LFL Y KTL+K K P F +E+ +K+R+AAL FK+W+GL Sbjct: 717 MMEKGNMFIDKYKYRALFLKYHKTLYKG-KAPKFQTESQLKKREAALAFKKWVGL 770 >ref|XP_010269003.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nelumbo nucifera] gi|720041730|ref|XP_010269004.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nelumbo nucifera] Length = 789 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MME +FIDKYKYRTLFL Y KTL+K KK P F +EA +RR+AAL FK+W+GL Sbjct: 735 MMEVENLFIDKYKYRTLFLKYHKTLYK-KKAPKFQTEAQCQRREAALAFKKWVGL 788 >ref|XP_009775482.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450357|ref|XP_009775488.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450364|ref|XP_009775494.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450369|ref|XP_009775502.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450375|ref|XP_009775510.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450381|ref|XP_009775518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450388|ref|XP_009775522.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450394|ref|XP_009775528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450400|ref|XP_009775539.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450407|ref|XP_009775545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450413|ref|XP_009775550.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450419|ref|XP_009775552.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450426|ref|XP_009775561.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450432|ref|XP_009775567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450438|ref|XP_009775573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450445|ref|XP_009775578.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450451|ref|XP_009775587.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450457|ref|XP_009775594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450464|ref|XP_009775597.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450470|ref|XP_009775605.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450476|ref|XP_009775614.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450483|ref|XP_009775620.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450489|ref|XP_009775628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] gi|698450495|ref|XP_009775636.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Nicotiana sylvestris] Length = 776 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = -3 Query: 498 MMEAGKMFIDKYKYRTLFLIYRKTLHKNKKTPNFHSEASVKRRDAALLFKEWLGL 334 MM+ G MFIDKYKYRTLFL Y KTL+K K P F SE +K+R+AAL FK W GL Sbjct: 722 MMDKGNMFIDKYKYRTLFLKYHKTLYKG-KAPKFQSETQMKKREAALNFKRWAGL 775