BLASTX nr result
ID: Papaver31_contig00052526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00052526 (604 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009620943.1| PREDICTED: uncharacterized protein LOC104112... 57 8e-06 >ref|XP_009620943.1| PREDICTED: uncharacterized protein LOC104112663 [Nicotiana tomentosiformis] Length = 233 Score = 57.0 bits (136), Expect = 8e-06 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -2 Query: 363 SEASLVGNVRE*WIDSGATSHNYADKDMFVSY-QSVDDETLFIGNSAPLNLSVNGSHY 193 SE SLVGN +E WIDSG+T H A+K++F SY + DET+F+GNSA + G Y Sbjct: 132 SECSLVGNPKEWWIDSGSTCHICANKELFASYVLAGPDETIFMGNSATTKIEGVGKIY 189