BLASTX nr result
ID: Papaver31_contig00052459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00052459 (590 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450209.1| hypothetical protein SORBIDRAFT_05g001992, p... 57 7e-06 ref|XP_002461565.1| hypothetical protein SORBIDRAFT_02g004790 [S... 57 9e-06 >ref|XP_002450209.1| hypothetical protein SORBIDRAFT_05g001992, partial [Sorghum bicolor] gi|241936052|gb|EES09197.1| hypothetical protein SORBIDRAFT_05g001992, partial [Sorghum bicolor] Length = 378 Score = 57.0 bits (136), Expect = 7e-06 Identities = 33/92 (35%), Positives = 53/92 (57%), Gaps = 6/92 (6%) Frame = -1 Query: 590 MHSKKRNRFLQQKLNDSVYIQYNKKL*RRYDLDHKYKRGAVKKPIFLEERNEDDECLDPA 411 MH+KKRNR L ++LND V++ YN+K+ R+ L + K+G + P+ +E+ + D+E D + Sbjct: 284 MHTKKRNRLLHKRLNDIVFVSYNRKMKTRFQL-RREKKGKIFDPLVIEDFDWDNEWADSS 342 Query: 410 NVDELYTLGDD------VLTLEQVRDVMGVNS 333 V G D LT E V + +G +S Sbjct: 343 YVHPQGARGCDNGDNGNGLTWEHVDEAVGASS 374 >ref|XP_002461565.1| hypothetical protein SORBIDRAFT_02g004790 [Sorghum bicolor] gi|241924942|gb|EER98086.1| hypothetical protein SORBIDRAFT_02g004790 [Sorghum bicolor] Length = 161 Score = 56.6 bits (135), Expect = 9e-06 Identities = 33/88 (37%), Positives = 49/88 (55%), Gaps = 3/88 (3%) Frame = -1 Query: 590 MHSKKRNRFLQQKLNDSVYIQYNKKL*RRYDLDHKYKRGAVKKPIFLEERNEDDECLDPA 411 MH+KKRNR L ++LND V++ YN+K+ R+ L + K G P+ +EE N D+E D Sbjct: 1 MHTKKRNRLLHKRLNDIVFVSYNRKMRTRFQL-MREKAGKKYDPLVIEEFNWDNEWADSL 59 Query: 410 NVDELYTLGDDV---LTLEQVRDVMGVN 336 +V G D LT + V + G + Sbjct: 60 HVSIPSARGSDAVDELTWQHVDEATGAS 87