BLASTX nr result
ID: Papaver31_contig00050708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00050708 (839 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010060532.1| PREDICTED: protochlorophyllide reductase, ch... 85 7e-14 ref|XP_010242003.1| PREDICTED: protochlorophyllide reductase-lik... 83 3e-13 emb|CDP05887.1| unnamed protein product [Coffea canephora] 83 3e-13 ref|XP_012084920.1| PREDICTED: protochlorophyllide reductase, ch... 83 3e-13 gb|KDO74131.1| hypothetical protein CISIN_1g015844mg [Citrus sin... 83 3e-13 gb|KDO74130.1| hypothetical protein CISIN_1g015844mg [Citrus sin... 83 3e-13 ref|XP_002534245.1| short-chain dehydrogenase, putative [Ricinus... 83 3e-13 ref|XP_006464717.1| PREDICTED: protochlorophyllide reductase, ch... 83 3e-13 ref|XP_006451927.1| hypothetical protein CICLE_v10008520mg [Citr... 83 3e-13 ref|XP_009774675.1| PREDICTED: protochlorophyllide reductase-lik... 82 5e-13 sp|Q9SDT1.1|POR_DAUCA RecName: Full=Protochlorophyllide reductas... 82 5e-13 ref|XP_006827825.1| PREDICTED: protochlorophyllide reductase [Am... 82 5e-13 ref|XP_011098331.1| PREDICTED: protochlorophyllide reductase [Se... 82 6e-13 ref|XP_011042487.1| PREDICTED: protochlorophyllide reductase, ch... 82 6e-13 ref|XP_011042486.1| PREDICTED: protochlorophyllide reductase, ch... 82 6e-13 ref|XP_009378484.1| PREDICTED: protochlorophyllide reductase, ch... 82 6e-13 ref|XP_008386137.1| PREDICTED: protochlorophyllide reductase, ch... 82 6e-13 ref|XP_007212349.1| hypothetical protein PRUPE_ppa006788mg [Prun... 82 6e-13 gb|KMZ72815.1| Protochlorophyllide reductase [Zostera marina] 81 8e-13 ref|XP_009343573.1| PREDICTED: protochlorophyllide reductase, ch... 81 8e-13 >ref|XP_010060532.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Eucalyptus grandis] gi|629101843|gb|KCW67312.1| hypothetical protein EUGRSUZ_F01098 [Eucalyptus grandis] Length = 398 Score = 84.7 bits (208), Expect = 7e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVWDVSEKLVG Sbjct: 357 SGVYWSWNKDSASFENQLSQEASDVEKARKVWDVSEKLVG 396 >ref|XP_010242003.1| PREDICTED: protochlorophyllide reductase-like [Nelumbo nucifera] Length = 400 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD DKARKVW++SEKLVG Sbjct: 359 SGVYWSWNKDSASFENQLSQEASDADKARKVWEISEKLVG 398 >emb|CDP05887.1| unnamed protein product [Coffea canephora] Length = 392 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 351 SGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVG 390 >ref|XP_012084920.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Jatropha curcas] gi|643714522|gb|KDP27025.1| hypothetical protein JCGZ_20960 [Jatropha curcas] Length = 399 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD DKARKVW++SEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSQEASDADKARKVWEISEKLVG 397 >gb|KDO74131.1| hypothetical protein CISIN_1g015844mg [Citrus sinensis] gi|641855346|gb|KDO74132.1| hypothetical protein CISIN_1g015844mg [Citrus sinensis] Length = 358 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 317 SGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVG 356 >gb|KDO74130.1| hypothetical protein CISIN_1g015844mg [Citrus sinensis] Length = 399 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVG 397 >ref|XP_002534245.1| short-chain dehydrogenase, putative [Ricinus communis] gi|223525646|gb|EEF28135.1| short-chain dehydrogenase, putative [Ricinus communis] Length = 396 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD DKARKVW++SEKLVG Sbjct: 355 SGVYWSWNKDSASFENQLSQEASDADKARKVWEISEKLVG 394 >ref|XP_006464717.1| PREDICTED: protochlorophyllide reductase, chloroplastic-like [Citrus sinensis] Length = 399 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVG 397 >ref|XP_006451927.1| hypothetical protein CICLE_v10008520mg [Citrus clementina] gi|557555153|gb|ESR65167.1| hypothetical protein CICLE_v10008520mg [Citrus clementina] Length = 399 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVG 397 >ref|XP_009774675.1| PREDICTED: protochlorophyllide reductase-like [Nicotiana sylvestris] gi|21068893|dbj|BAB93003.1| NADPH:protochlorophyllide oxidoreductase [Nicotiana tabacum] Length = 397 Score = 82.0 bits (201), Expect = 5e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLS+EASDV+KARKVW+VSEKLVG Sbjct: 356 SGVYWSWNKDSASFENQLSEEASDVEKARKVWEVSEKLVG 395 >sp|Q9SDT1.1|POR_DAUCA RecName: Full=Protochlorophyllide reductase, chloroplastic; Short=PCR; AltName: Full=NADPH-protochlorophyllide oxidoreductase; Short=POR; Flags: Precursor gi|6644198|gb|AAF20949.1|AF207691_1 NADPH:protochlorophyllide oxidoreductase [Daucus carota] Length = 398 Score = 82.0 bits (201), Expect = 5e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLS+EASDV+KARKVW+VSEKLVG Sbjct: 357 SGVYWSWNKDSASFENQLSEEASDVEKARKVWEVSEKLVG 396 >ref|XP_006827825.1| PREDICTED: protochlorophyllide reductase [Amborella trichopoda] gi|548832445|gb|ERM95241.1| hypothetical protein AMTR_s00009p00268600 [Amborella trichopoda] Length = 404 Score = 82.0 bits (201), Expect = 5e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASDV+KARKVW++SEKLVG Sbjct: 363 SGVYWSWNKDSASFENQLSQEASDVEKARKVWELSEKLVG 402 >ref|XP_011098331.1| PREDICTED: protochlorophyllide reductase [Sesamum indicum] Length = 400 Score = 81.6 bits (200), Expect = 6e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLS+EASD DKARKVW++SEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSEEASDADKARKVWEISEKLVG 397 >ref|XP_011042487.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X2 [Populus euphratica] gi|743938496|ref|XP_011013676.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X2 [Populus euphratica] Length = 399 Score = 81.6 bits (200), Expect = 6e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD +KARKVW+VSEKLVG Sbjct: 358 SGVYWSWNKDSASFENQLSQEASDAEKARKVWEVSEKLVG 397 >ref|XP_011042486.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X1 [Populus euphratica] gi|743938494|ref|XP_011013675.1| PREDICTED: protochlorophyllide reductase, chloroplastic isoform X1 [Populus euphratica] Length = 400 Score = 81.6 bits (200), Expect = 6e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD +KARKVW+VSEKLVG Sbjct: 359 SGVYWSWNKDSASFENQLSQEASDAEKARKVWEVSEKLVG 398 >ref|XP_009378484.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Pyrus x bretschneideri] Length = 395 Score = 81.6 bits (200), Expect = 6e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD +KARKVW+VSEKLVG Sbjct: 354 SGVYWSWNKDSASFENQLSQEASDAEKARKVWEVSEKLVG 393 >ref|XP_008386137.1| PREDICTED: protochlorophyllide reductase, chloroplastic-like [Malus domestica] Length = 395 Score = 81.6 bits (200), Expect = 6e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD +KARKVW+VSEKLVG Sbjct: 354 SGVYWSWNKDSASFENQLSQEASDAEKARKVWEVSEKLVG 393 >ref|XP_007212349.1| hypothetical protein PRUPE_ppa006788mg [Prunus persica] gi|462408214|gb|EMJ13548.1| hypothetical protein PRUPE_ppa006788mg [Prunus persica] Length = 395 Score = 81.6 bits (200), Expect = 6e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNKDSASFENQLSQEASD +KARKVW+VSEKLVG Sbjct: 354 SGVYWSWNKDSASFENQLSQEASDAEKARKVWEVSEKLVG 393 >gb|KMZ72815.1| Protochlorophyllide reductase [Zostera marina] Length = 391 Score = 81.3 bits (199), Expect = 8e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNK +ASFENQLSQEASDVDKARKVWD+SEKLVG Sbjct: 350 SGVYWSWNKTAASFENQLSQEASDVDKARKVWDLSEKLVG 389 >ref|XP_009343573.1| PREDICTED: protochlorophyllide reductase, chloroplastic [Pyrus x bretschneideri] Length = 395 Score = 81.3 bits (199), Expect = 8e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 838 SGVYWSWNKDSASFENQLSQEASDVDKARKVWDVSEKLVG 719 SGVYWSWNK+SASFENQLSQEASDV+KARKVW+VSEKLVG Sbjct: 354 SGVYWSWNKNSASFENQLSQEASDVEKARKVWEVSEKLVG 393