BLASTX nr result
ID: Papaver31_contig00050634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00050634 (796 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097311.1| F-box protein [Morus notabilis] gi|587878545... 64 1e-07 gb|KCW59968.1| hypothetical protein EUGRSUZ_H02694 [Eucalyptus g... 62 6e-07 ref|XP_010026696.1| PREDICTED: F-box/kelch-repeat protein At3g06... 61 8e-07 ref|XP_013442609.1| F-box protein interaction domain protein [Me... 61 8e-07 ref|XP_013442605.1| F-box protein interaction domain protein [Me... 60 2e-06 ref|XP_010026698.1| PREDICTED: F-box/kelch-repeat protein At3g06... 59 3e-06 ref|XP_009609989.1| PREDICTED: putative F-box protein At1g50870 ... 59 4e-06 ref|XP_013459363.1| F-box protein interaction domain protein [Me... 59 5e-06 ref|XP_013441861.1| F-box protein interaction domain protein [Me... 59 5e-06 gb|KRG99672.1| hypothetical protein GLYMA_18G162300 [Glycine max] 58 7e-06 ref|XP_009626748.1| PREDICTED: putative F-box protein At1g32420 ... 58 9e-06 ref|XP_013448873.1| F-box protein interaction domain protein [Me... 58 9e-06 >ref|XP_010097311.1| F-box protein [Morus notabilis] gi|587878545|gb|EXB67543.1| F-box protein [Morus notabilis] Length = 395 Score = 63.9 bits (154), Expect = 1e-07 Identities = 37/96 (38%), Positives = 50/96 (52%), Gaps = 6/96 (6%) Frame = -3 Query: 332 DDVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLT-RSVKRPMFFYVI---- 168 +D++ EIL +L +K+LMRFKCVSK+W LI NDP FI HL K FF +I Sbjct: 9 EDMVITEILPKLPVKSLMRFKCVSKKWFSLITNDPKFIAAHLQYHQSKNTKFFSIIERKH 68 Query: 167 -PLWNYWRAQKEDIRYRGYDELLLTTDLSNQSRAEN 63 P+W Y + + Y D + T L + N Sbjct: 69 DPVWKYELGKFLVLNYESKDAIFDQTYLEKSYLSSN 104 >gb|KCW59968.1| hypothetical protein EUGRSUZ_H02694 [Eucalyptus grandis] Length = 295 Score = 61.6 bits (148), Expect = 6e-07 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 332 DDVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSV 195 ++ I +ILSRL +K+LMRFKCVSKRWR LI +DPHF KLHL R + Sbjct: 7 EEDIIIDILSRLPVKSLMRFKCVSKRWRSLI-SDPHFAKLHLQRLI 51 >ref|XP_010026696.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Eucalyptus grandis] Length = 294 Score = 61.2 bits (147), Expect = 8e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 323 IAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSV 195 I +ILSRL +K+LMRFKCVSKRWR LI +DPHF KLHL R + Sbjct: 9 IIIDILSRLPVKSLMRFKCVSKRWRSLI-SDPHFAKLHLQRLI 50 >ref|XP_013442609.1| F-box protein interaction domain protein [Medicago truncatula] gi|657370527|gb|KEH16634.1| F-box protein interaction domain protein [Medicago truncatula] Length = 398 Score = 61.2 bits (147), Expect = 8e-07 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -3 Query: 329 DVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRPMFFYVIPLWNYW 150 D + EIL L +K+LM+ KCVSK W+ LI N P FIK+HL+RS + P F V+P Y+ Sbjct: 24 DEVITEILLWLPVKSLMQMKCVSKSWKTLISN-PSFIKMHLSRSARNPYFSSVVPTRGYY 82 >ref|XP_013442605.1| F-box protein interaction domain protein [Medicago truncatula] gi|657370523|gb|KEH16630.1| F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -3 Query: 314 EILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRPMFFYVIPLWNYW 150 EILS L +K+LM+ KCVSK W+ LI + P FIK+HL+RS + P F ++P Y+ Sbjct: 25 EILSWLPVKSLMQMKCVSKSWKTLISHPP-FIKMHLSRSARNPYFSSIVPTRGYY 78 >ref|XP_010026698.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Eucalyptus grandis] gi|629093975|gb|KCW59970.1| hypothetical protein EUGRSUZ_H02696 [Eucalyptus grandis] Length = 369 Score = 59.3 bits (142), Expect = 3e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -3 Query: 323 IAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSV 195 I EILSRL +K+L+RFKCVSKRWR LI ++PHF KLHL R + Sbjct: 24 ILIEILSRLPVKSLVRFKCVSKRWRSLI-SEPHFAKLHLQRLI 65 >ref|XP_009609989.1| PREDICTED: putative F-box protein At1g50870 [Nicotiana tomentosiformis] Length = 364 Score = 58.9 bits (141), Expect = 4e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = -3 Query: 317 YEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRPM 183 +E+L+ L K+LMRF+CVSK W I +DPHF+KLH RS RP+ Sbjct: 30 FEVLTWLPAKSLMRFRCVSKAWNSFIRHDPHFVKLHNARSQTRPL 74 >ref|XP_013459363.1| F-box protein interaction domain protein [Medicago truncatula] gi|657392443|gb|KEH33394.1| F-box protein interaction domain protein [Medicago truncatula] Length = 466 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -3 Query: 329 DVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRS 198 D + EILSRL +K LM+FKCV K W+ LI +DP F KLHL RS Sbjct: 25 DELIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLRRS 68 >ref|XP_013441861.1| F-box protein interaction domain protein [Medicago truncatula] gi|657369443|gb|KEH15886.1| F-box protein interaction domain protein [Medicago truncatula] Length = 430 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -3 Query: 329 DVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRS 198 D + EILSRL +K LM+FKCV K W+ LI +DP F KLHL RS Sbjct: 25 DELIVEILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLHLQRS 68 >gb|KRG99672.1| hypothetical protein GLYMA_18G162300 [Glycine max] Length = 331 Score = 58.2 bits (139), Expect = 7e-06 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 7/71 (9%) Frame = -3 Query: 347 VWS---CNDDVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRPMF- 180 +WS CN+ I EILSRL +K L++FKCV K W LI ++P+FIKLHL++S + F Sbjct: 9 LWSPLLCNE--IIKEILSRLPVKPLIQFKCVCKEWNSLI-SEPYFIKLHLSKSAAKDDFE 65 Query: 179 ---FYVIPLWN 156 Y + LWN Sbjct: 66 VPEGYCVCLWN 76 >ref|XP_009626748.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis] Length = 346 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = -3 Query: 338 CNDDVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRP 186 C DD++ ++IL+ L K+LMRFKCVSK W I++DP F+KLH RS+ RP Sbjct: 5 CVDDIV-FQILTWLPAKSLMRFKCVSKTWN--IQHDPDFVKLHNARSLARP 52 >ref|XP_013448873.1| F-box protein interaction domain protein [Medicago truncatula] gi|657378107|gb|KEH22900.1| F-box protein interaction domain protein [Medicago truncatula] Length = 398 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -3 Query: 329 DVIAYEILSRLTIKALMRFKCVSKRWRWLIENDPHFIKLHLTRSVKRP 186 D + YEILS LT+K LM+ KCVSK W+ +I +DP F K+HL RS + P Sbjct: 26 DELIYEILSWLTVKLLMQLKCVSKSWKTII-SDPKFAKMHLNRSARNP 72