BLASTX nr result
ID: Papaver31_contig00049583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00049583 (818 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107526.1| hypothetical protein L484_024379 [Morus nota... 60 1e-06 >ref|XP_010107526.1| hypothetical protein L484_024379 [Morus notabilis] gi|587929033|gb|EXC16208.1| hypothetical protein L484_024379 [Morus notabilis] Length = 402 Score = 60.5 bits (145), Expect = 1e-06 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +1 Query: 1 ISDNAYVIDLPSDWNISNTFNVQEIFTFHGDNELLIYTENSRTSLIQEGGD 153 +SDNAYV+ LP DW IS+TFNV +++T+ ++ ++ ENS +S QEGG+ Sbjct: 352 VSDNAYVVGLPDDWEISSTFNVADLYTYFPPDDASMHLENSGSSSFQEGGN 402