BLASTX nr result
ID: Papaver31_contig00048868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00048868 (410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489986.1| PREDICTED: exosome complex component RRP43-l... 60 1e-10 ref|XP_006421389.1| hypothetical protein CICLE_v10005512mg [Citr... 60 1e-10 ref|XP_002308947.1| 3' exoribonuclease domain 1-containing famil... 59 6e-10 ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Popu... 59 6e-10 ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-l... 59 8e-10 ref|XP_007028731.1| 3'-5'-exoribonuclease family protein [Theobr... 57 8e-10 ref|XP_006351314.1| PREDICTED: exosome complex component RRP43 [... 57 1e-09 ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-l... 55 3e-09 ref|XP_002532079.1| exosome complex exonuclease rrp43, putative ... 57 3e-09 ref|XP_009597188.1| PREDICTED: exosome complex component RRP43 [... 55 3e-09 ref|XP_003544676.1| PREDICTED: exosome complex component RRP43-l... 55 3e-09 emb|CAN82224.1| hypothetical protein VITISV_011872 [Vitis vinifera] 57 5e-09 emb|CBI29839.3| unnamed protein product [Vitis vinifera] 57 5e-09 ref|XP_002284088.1| PREDICTED: exosome complex component RRP43 [... 57 5e-09 ref|XP_009780009.1| PREDICTED: exosome complex component RRP43 [... 54 5e-09 gb|KHN14032.1| Exosome complex component RRP43 [Glycine soja] 55 1e-08 ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-l... 55 1e-08 ref|XP_008222119.1| PREDICTED: exosome complex component RRP43 [... 57 1e-08 ref|XP_007202373.1| hypothetical protein PRUPE_ppa009278mg [Prun... 57 1e-08 ref|XP_006602939.1| PREDICTED: exosome complex component RRP43 i... 55 1e-08 >ref|XP_006489986.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Citrus sinensis] gi|568873742|ref|XP_006489987.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Citrus sinensis] Length = 302 Score = 60.1 bits (144), Expect(2) = 1e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL +PF LTC+LH NYILADP ++EESIMETLV LD SN Sbjct: 214 TLGGIPFSLTCILHKNYILADPTSEEESIMETLVTVVLDSSN 255 Score = 32.3 bits (72), Expect(2) = 1e-10 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKEPHQ 187 L+ L K GG +LA T VQ C+ + VKE HQ Sbjct: 257 LVSLYKPGGAVLAYTSAVQDCIALTRQRVKELHQ 290 >ref|XP_006421389.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|567857414|ref|XP_006421390.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|557523262|gb|ESR34629.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|557523263|gb|ESR34630.1| hypothetical protein CICLE_v10005512mg [Citrus clementina] gi|641821569|gb|KDO41222.1| hypothetical protein CISIN_1g022140mg [Citrus sinensis] Length = 302 Score = 60.1 bits (144), Expect(2) = 1e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL +PF LTC+LH NYILADP ++EESIMETLV LD SN Sbjct: 214 TLGGIPFSLTCILHKNYILADPTSEEESIMETLVTVVLDSSN 255 Score = 32.3 bits (72), Expect(2) = 1e-10 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKEPHQ 187 L+ L K GG +LA T VQ C+ + VKE HQ Sbjct: 257 LVSLYKPGGAVLAYTSAVQDCIALTRQRVKELHQ 290 >ref|XP_002308947.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] gi|222854923|gb|EEE92470.1| 3' exoribonuclease domain 1-containing family protein [Populus trichocarpa] Length = 318 Score = 58.5 bits (140), Expect(2) = 6e-10 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S+ Sbjct: 230 TLSSIPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSS 271 Score = 31.6 bits (70), Expect(2) = 6e-10 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKEPHQS*TETFQILKL 154 L+ K GGP+LA T VQ CV + VKE ET +++ Sbjct: 273 LVSFYKPGGPVLAQTSAVQDCVALTRQRVKELQDILDETISGMEI 317 >ref|XP_006381009.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] gi|550335486|gb|ERP58806.1| hypothetical protein POPTR_0006s04970g [Populus trichocarpa] Length = 303 Score = 58.5 bits (140), Expect(2) = 6e-10 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S+ Sbjct: 215 TLSSIPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSS 256 Score = 31.6 bits (70), Expect(2) = 6e-10 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKEPHQS*TETFQILKL 154 L+ K GGP+LA T VQ CV + VKE ET +++ Sbjct: 258 LVSFYKPGGPVLAQTSAVQDCVALTRQRVKELQDILDETISGMEI 302 >ref|XP_011048048.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] gi|743909153|ref|XP_011048049.1| PREDICTED: exosome complex component RRP43-like [Populus euphratica] Length = 303 Score = 58.5 bits (140), Expect(2) = 8e-10 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S+ Sbjct: 215 TLSSIPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSSS 256 Score = 31.2 bits (69), Expect(2) = 8e-10 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ K GGP+LA T VQ CV + VKE Sbjct: 258 LVSFYKPGGPVLAQTSAVQDCVALTRQRVKE 288 >ref|XP_007028731.1| 3'-5'-exoribonuclease family protein [Theobroma cacao] gi|508717336|gb|EOY09233.1| 3'-5'-exoribonuclease family protein [Theobroma cacao] Length = 302 Score = 56.6 bits (135), Expect(2) = 8e-10 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLSN 284 TL +PF LTC+LH NYILADP +EESIMETLV LD S+ Sbjct: 214 TLCSIPFSLTCILHKNYILADPTAEEESIMETLVTIVLDSSS 255 Score = 33.1 bits (74), Expect(2) = 8e-10 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKEPHQS*TETFQILKL 154 L+ L K GGP+LA T +Q C+ + VKE + E ++++ Sbjct: 257 LVSLYKPGGPVLAYTSAIQDCIAITRQRVKELQKILEEAISVMEV 301 >ref|XP_006351314.1| PREDICTED: exosome complex component RRP43 [Solanum tuberosum] Length = 303 Score = 56.6 bits (135), Expect(2) = 1e-09 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 406 LNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 LN +PF LTC+LH NYILADP +EESIMET+V LD S Sbjct: 216 LNSLPFSLTCILHKNYILADPTAEEESIMETIVTMVLDSS 255 Score = 32.3 bits (72), Expect(2) = 1e-09 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L+K GGP+L+ T V+Q C+ + VKE Sbjct: 258 LVSLNKPGGPVLSHTSVIQDCIALARRRVKE 288 >ref|XP_006596183.1| PREDICTED: exosome complex component RRP43-like isoform X2 [Glycine max] gi|571509870|ref|XP_006596184.1| PREDICTED: exosome complex component RRP43-like isoform X3 [Glycine max] gi|947067137|gb|KRH16280.1| hypothetical protein GLYMA_14G145600 [Glycine max] Length = 307 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTC+LH NYILADP +EESIMET V LD S Sbjct: 218 TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTIVLDTS 258 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 LI L K GGP LA T +Q CVG+ VKE Sbjct: 261 LISLYKPGGPALAYTSAIQDCVGLTGQRVKE 291 >ref|XP_002532079.1| exosome complex exonuclease rrp43, putative [Ricinus communis] gi|223528261|gb|EEF30313.1| exosome complex exonuclease rrp43, putative [Ricinus communis] Length = 303 Score = 57.4 bits (137), Expect(2) = 3e-09 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTCVLH NYILADP +EESIMETLV LD S Sbjct: 215 TLRSLPFSLTCVLHKNYILADPTAEEESIMETLVTVVLDSS 255 Score = 30.4 bits (67), Expect(2) = 3e-09 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ K GGP+LA T VQ CV + VKE Sbjct: 258 LVSFYKPGGPVLAYTSAVQDCVALTRQRVKE 288 >ref|XP_009597188.1| PREDICTED: exosome complex component RRP43 [Nicotiana tomentosiformis] Length = 303 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -2 Query: 406 LNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 LN PF LTC+LH NYILADP +EESIMET+V LD S Sbjct: 216 LNSPPFSLTCILHKNYILADPTAEEESIMETVVTVVLDSS 255 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA T V+Q CV + VKE Sbjct: 258 LVSLYKPGGPVLAHTSVIQDCVALTRRRVKE 288 >ref|XP_003544676.1| PREDICTED: exosome complex component RRP43-like isoform X1 [Glycine max] gi|571509874|ref|XP_006596185.1| PREDICTED: exosome complex component RRP43-like isoform X4 [Glycine max] gi|734393934|gb|KHN28404.1| Exosome complex component RRP43 [Glycine soja] gi|947067138|gb|KRH16281.1| hypothetical protein GLYMA_14G145600 [Glycine max] gi|947067139|gb|KRH16282.1| hypothetical protein GLYMA_14G145600 [Glycine max] Length = 299 Score = 55.1 bits (131), Expect(2) = 3e-09 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTC+LH NYILADP +EESIMET V LD S Sbjct: 210 TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTIVLDTS 250 Score = 32.7 bits (73), Expect(2) = 3e-09 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 LI L K GGP LA T +Q CVG+ VKE Sbjct: 253 LISLYKPGGPALAYTSAIQDCVGLTGQRVKE 283 >emb|CAN82224.1| hypothetical protein VITISV_011872 [Vitis vinifera] Length = 1621 Score = 57.4 bits (137), Expect(2) = 5e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S Sbjct: 216 TLSSLPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSS 256 Score = 29.6 bits (65), Expect(2) = 5e-09 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA VQ C+ + VKE Sbjct: 259 LVSLYKPGGPVLAYASAVQDCIALTRQRVKE 289 >emb|CBI29839.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 57.4 bits (137), Expect(2) = 5e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S Sbjct: 223 TLSSLPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSS 263 Score = 29.6 bits (65), Expect(2) = 5e-09 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA VQ C+ + VKE Sbjct: 266 LVSLYKPGGPVLAYASAVQDCIALTRQRVKE 296 >ref|XP_002284088.1| PREDICTED: exosome complex component RRP43 [Vitis vinifera] gi|731399877|ref|XP_010653776.1| PREDICTED: exosome complex component RRP43 [Vitis vinifera] Length = 303 Score = 57.4 bits (137), Expect(2) = 5e-09 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL+ +PF LTC+LH NYILADP +EESIMETLV LD S Sbjct: 215 TLSSLPFSLTCILHKNYILADPTAEEESIMETLVTVVLDSS 255 Score = 29.6 bits (65), Expect(2) = 5e-09 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA VQ C+ + VKE Sbjct: 258 LVSLYKPGGPVLAYASAVQDCIALTRQRVKE 288 >ref|XP_009780009.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422013|ref|XP_009780016.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422019|ref|XP_009780020.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] gi|698422026|ref|XP_009780025.1| PREDICTED: exosome complex component RRP43 [Nicotiana sylvestris] Length = 303 Score = 54.3 bits (129), Expect(2) = 5e-09 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 406 LNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALD 293 LN PF LTC+LH NYILADP +EESIMET+V LD Sbjct: 216 LNSPPFSLTCILHKNYILADPTAEEESIMETVVTVVLD 253 Score = 32.7 bits (73), Expect(2) = 5e-09 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA T V+Q CV + VKE Sbjct: 258 LVSLYKPGGPVLAHTSVIQDCVALARRRVKE 288 >gb|KHN14032.1| Exosome complex component RRP43 [Glycine soja] Length = 302 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTC+LH NYILADP +EESIMET V LD S Sbjct: 214 TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTVVLDTS 254 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 LI L K GGP+LA T +Q C + VKE Sbjct: 257 LISLYKPGGPVLAYTSAIQDCAALTRQRVKE 287 >ref|XP_003531860.1| PREDICTED: exosome complex component RRP43-like [Glycine max] gi|947096468|gb|KRH45053.1| hypothetical protein GLYMA_08G246800 [Glycine max] Length = 302 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTC+LH NYILADP +EESIMET V LD S Sbjct: 214 TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTVVLDTS 254 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 LI L K GGP+LA T +Q C + VKE Sbjct: 257 LISLYKPGGPVLAYTSAIQDCAALTRQRVKE 287 >ref|XP_008222119.1| PREDICTED: exosome complex component RRP43 [Prunus mume] gi|645230848|ref|XP_008222120.1| PREDICTED: exosome complex component RRP43 [Prunus mume] Length = 299 Score = 57.0 bits (136), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL+ +PF LTC+LH NYILADP +EES+METLV LD S Sbjct: 211 TLSSIPFSLTCLLHKNYILADPTAEEESVMETLVTVVLDSS 251 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA T +Q CV + +E Sbjct: 254 LVSLYKPGGPVLAYTSAIQDCVALTRQRARE 284 >ref|XP_007202373.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica] gi|462397904|gb|EMJ03572.1| hypothetical protein PRUPE_ppa009278mg [Prunus persica] Length = 299 Score = 57.0 bits (136), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL+ +PF LTC+LH NYILADP +EES+METLV LD S Sbjct: 211 TLSSIPFSLTCLLHKNYILADPTAEEESVMETLVTVVLDSS 251 Score = 28.9 bits (63), Expect(2) = 1e-08 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 L+ L K GGP+LA T +Q CV + +E Sbjct: 254 LVSLYKPGGPVLAYTSAIQDCVALTRQRARE 284 >ref|XP_006602939.1| PREDICTED: exosome complex component RRP43 isoform X1 [Glycine max] gi|571549405|ref|XP_006602940.1| PREDICTED: exosome complex component RRP43 isoform X2 [Glycine max] Length = 203 Score = 55.5 bits (132), Expect(2) = 1e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -2 Query: 409 TLNRVPF*LTCVLH*NYILADPITQEESIMETLVKEALDLS 287 TL +PF LTC+LH NYILADP +EESIMET V LD S Sbjct: 116 TLRSIPFSLTCILHKNYILADPTAEEESIMETHVTVVLDTS 156 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -3 Query: 288 LICLSKVGGPLLAST*VVQGCVGVKEDGVKE 196 LI L K GGP+LA T +Q C + VKE Sbjct: 159 LISLYKPGGPVLAYTSAIQDCAALTRQRVKE 189