BLASTX nr result
ID: Papaver31_contig00048577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00048577 (444 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249887.1| PREDICTED: tudor domain-containing protein 3... 58 2e-06 >ref|XP_010249887.1| PREDICTED: tudor domain-containing protein 3 [Nelumbo nucifera] Length = 417 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -1 Query: 168 ISLILETLIHKGWCFRNIEEISSQIHNHISTVNNRVSADSIESELLLNMDLKIIGG 1 + ++LE LI +GWCFR++EE+ I +I+ S DS+ESE LLN+DLK IGG Sbjct: 1 MEVVLEALIRRGWCFRDVEEVKGLIQINIALSGELGSVDSVESE-LLNLDLKSIGG 55