BLASTX nr result
ID: Papaver31_contig00048310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00048310 (618 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012479908.1| PREDICTED: brefeldin A-inhibited guanine nuc... 67 2e-19 gb|KJB31956.1| hypothetical protein B456_005G215900 [Gossypium r... 67 2e-19 gb|KJB31955.1| hypothetical protein B456_005G215900 [Gossypium r... 67 2e-19 gb|KHG17239.1| Brefeldin A-inhibited guanine nucleotide-exchange... 67 2e-19 ref|XP_002280001.1| PREDICTED: brefeldin A-inhibited guanine nuc... 64 2e-19 gb|KHG11520.1| Brefeldin A-inhibited guanine nucleotide-exchange... 65 2e-19 emb|CBI37718.3| unnamed protein product [Vitis vinifera] 64 2e-19 emb|CAN72216.1| hypothetical protein VITISV_039085 [Vitis vinifera] 64 2e-19 ref|XP_010266282.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 3e-19 gb|KNA03970.1| hypothetical protein SOVF_204040 [Spinacia oleracea] 63 4e-19 ref|XP_010690583.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 4e-19 ref|XP_010690584.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 4e-19 ref|XP_007043107.1| SEC7-like guanine nucleotide exchange family... 64 6e-19 ref|XP_006412110.1| hypothetical protein EUTSA_v10024200mg [Eutr... 64 6e-19 ref|XP_009358900.1| PREDICTED: brefeldin A-inhibited guanine nuc... 62 7e-19 ref|XP_008382511.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-... 62 7e-19 ref|XP_010548183.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 7e-19 ref|XP_012075487.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 9e-19 ref|XP_003519698.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 9e-19 ref|XP_014524296.1| PREDICTED: brefeldin A-inhibited guanine nuc... 63 9e-19 >ref|XP_012479908.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Gossypium raimondii] Length = 1716 Score = 66.6 bits (161), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV YV MVL+R +NVKSG KSVFM Sbjct: 1128 EFLRPFVIVMQKSNSIEIRELIVRYVSQMVLSRVSNVKSGWKSVFM 1173 Score = 56.6 bits (135), Expect(2) = 2e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV RI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1075 LVWFRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1112 >gb|KJB31956.1| hypothetical protein B456_005G215900 [Gossypium raimondii] Length = 1691 Score = 66.6 bits (161), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV YV MVL+R +NVKSG KSVFM Sbjct: 1103 EFLRPFVIVMQKSNSIEIRELIVRYVSQMVLSRVSNVKSGWKSVFM 1148 Score = 56.6 bits (135), Expect(2) = 2e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV RI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1050 LVWFRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1087 >gb|KJB31955.1| hypothetical protein B456_005G215900 [Gossypium raimondii] Length = 1489 Score = 66.6 bits (161), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV YV MVL+R +NVKSG KSVFM Sbjct: 1103 EFLRPFVIVMQKSNSIEIRELIVRYVSQMVLSRVSNVKSGWKSVFM 1148 Score = 56.6 bits (135), Expect(2) = 2e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV RI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1050 LVWFRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1087 >gb|KHG17239.1| Brefeldin A-inhibited guanine nucleotide-exchange 2 [Gossypium arboreum] Length = 1296 Score = 66.6 bits (161), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV YV MVL+R +NVKSG KSVFM Sbjct: 708 EFLRPFVIVMQKSNSIEIRELIVRYVSQMVLSRVSNVKSGWKSVFM 753 Score = 56.6 bits (135), Expect(2) = 2e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV RI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 655 LVWFRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 692 >ref|XP_002280001.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Vitis vinifera] gi|731382550|ref|XP_010645628.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Vitis vinifera] Length = 1702 Score = 63.9 bits (154), Expect(2) = 2e-19 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E++ELIV + MVL+R NNVKSG KSVFM Sbjct: 1106 EFLRPFVIVMQKSNSTEIKELIVRCISQMVLSRVNNVKSGWKSVFM 1151 Score = 58.9 bits (141), Expect(2) = 2e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1053 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1090 >gb|KHG11520.1| Brefeldin A-inhibited guanine nucleotide-exchange 2 [Gossypium arboreum] Length = 1667 Score = 65.1 bits (157), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF IIMQKSN AE+RELIV + MVL+R NVKSG KSVFM Sbjct: 1072 RFLRPFVIIMQKSNSAEIRELIVRCISQMVLSRVTNVKSGWKSVFM 1117 Score = 57.8 bits (138), Expect(2) = 2e-19 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SR+ NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1019 LVWSRMWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1056 >emb|CBI37718.3| unnamed protein product [Vitis vinifera] Length = 1611 Score = 63.9 bits (154), Expect(2) = 2e-19 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E++ELIV + MVL+R NNVKSG KSVFM Sbjct: 1015 EFLRPFVIVMQKSNSTEIKELIVRCISQMVLSRVNNVKSGWKSVFM 1060 Score = 58.9 bits (141), Expect(2) = 2e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 962 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 999 >emb|CAN72216.1| hypothetical protein VITISV_039085 [Vitis vinifera] Length = 1236 Score = 63.9 bits (154), Expect(2) = 2e-19 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E++ELIV + MVL+R NNVKSG KSVFM Sbjct: 629 EFLRPFVIVMQKSNSTEIKELIVRCISQMVLSRVNNVKSGWKSVFM 674 Score = 58.9 bits (141), Expect(2) = 2e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 576 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 613 >ref|XP_010266282.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Nelumbo nucifera] Length = 1725 Score = 63.2 bits (152), Expect(2) = 3e-19 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKS+ AE+RELIV + MVL R NNVKSG KSVFM Sbjct: 1129 EFLRPFVIVMQKSSSAEIRELIVRCISQMVLIRVNNVKSGWKSVFM 1174 Score = 58.9 bits (141), Expect(2) = 3e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1076 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1113 >gb|KNA03970.1| hypothetical protein SOVF_204040 [Spinacia oleracea] Length = 1752 Score = 62.8 bits (151), Expect(2) = 4e-19 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKS+ AE+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1156 EFLRPFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1201 Score = 58.9 bits (141), Expect(2) = 4e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1103 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1140 >ref|XP_010690583.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870849333|gb|KMT01596.1| hypothetical protein BVRB_9g215920 [Beta vulgaris subsp. vulgaris] Length = 1749 Score = 62.8 bits (151), Expect(2) = 4e-19 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKS+ AE+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1156 EFLRPFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1201 Score = 58.9 bits (141), Expect(2) = 4e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1103 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1140 >ref|XP_010690584.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 1281 Score = 62.8 bits (151), Expect(2) = 4e-19 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKS+ AE+RELIV + MVL+R +NVKSG KSVFM Sbjct: 688 EFLRPFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFM 733 Score = 58.9 bits (141), Expect(2) = 4e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 635 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 672 >ref|XP_007043107.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] gi|508707042|gb|EOX98938.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] Length = 1725 Score = 63.5 bits (153), Expect(2) = 6e-19 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+M+KSN AE+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1130 EFLRPFVIVMEKSNTAEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1175 Score = 57.8 bits (138), Expect(2) = 6e-19 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SR+ NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1077 LVWSRMWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1114 >ref|XP_006412110.1| hypothetical protein EUTSA_v10024200mg [Eutrema salsugineum] gi|557113280|gb|ESQ53563.1| hypothetical protein EUTSA_v10024200mg [Eutrema salsugineum] Length = 1691 Score = 63.5 bits (153), Expect(2) = 6e-19 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -3 Query: 394 YKFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVF 257 ++FL+PFAI+MQKS+ AE+RELIV V MVL+R +NVKSG KSVF Sbjct: 1126 HEFLRPFAIVMQKSSSAEIRELIVRCVSQMVLSRVSNVKSGWKSVF 1171 Score = 57.8 bits (138), Expect(2) = 6e-19 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQL++ Sbjct: 1074 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLSM 1111 >ref|XP_009358900.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Pyrus x bretschneideri] Length = 1715 Score = 62.0 bits (149), Expect(2) = 7e-19 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV + MVL+R N+VKSG KSVF+ Sbjct: 1119 EFLRPFVIVMQKSNSTEIRELIVRCISQMVLSRVNHVKSGWKSVFL 1164 Score = 58.9 bits (141), Expect(2) = 7e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1066 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1103 >ref|XP_008382511.1| PREDICTED: LOW QUALITY PROTEIN: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Malus domestica] Length = 1715 Score = 62.0 bits (149), Expect(2) = 7e-19 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV + MVL+R N+VKSG KSVF+ Sbjct: 1120 EFLRPFVIVMQKSNSTEIRELIVRCISQMVLSRVNHVKSGWKSVFL 1165 Score = 58.9 bits (141), Expect(2) = 7e-19 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1067 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1104 >ref|XP_010548183.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 4 isoform X1 [Tarenaya hassleriana] gi|729371172|ref|XP_010548184.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 4 isoform X2 [Tarenaya hassleriana] Length = 1702 Score = 63.2 bits (152), Expect(2) = 7e-19 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 394 YKFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 ++FL+PF I+MQKS+ AE+RELIV V MVL+R NVKSG KSVFM Sbjct: 1122 HEFLQPFVIVMQKSSSAEIRELIVRCVSQMVLSRVGNVKSGWKSVFM 1168 Score = 57.8 bits (138), Expect(2) = 7e-19 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIFV+DSLRQL++ Sbjct: 1070 LVWSRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLSM 1107 >ref|XP_012075487.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Jatropha curcas] gi|643741616|gb|KDP47031.1| hypothetical protein JCGZ_10758 [Jatropha curcas] Length = 1738 Score = 62.8 bits (151), Expect(2) = 9e-19 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKS+ AE+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1144 EFLRPFVIVMQKSSSAEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1189 Score = 57.8 bits (138), Expect(2) = 9e-19 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV +RI NVLSDFFVS+GLS NLSVAIFV+DSLRQLA+ Sbjct: 1091 LVWTRIWNVLSDFFVSVGLSENLSVAIFVMDSLRQLAM 1128 >ref|XP_003519698.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like isoform 1 [Glycine max] gi|947125905|gb|KRH74111.1| hypothetical protein GLYMA_02G312200 [Glycine max] Length = 1721 Score = 63.2 bits (152), Expect(2) = 9e-19 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1128 EFLRPFVIVMQKSNTTEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1173 Score = 57.4 bits (137), Expect(2) = 9e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIF +DSLRQLA+ Sbjct: 1075 LVWSRIWNVLSDFFVSVGLSENLSVAIFAMDSLRQLAM 1112 >ref|XP_014524296.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Vigna radiata var. radiata] Length = 1715 Score = 63.2 bits (152), Expect(2) = 9e-19 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -3 Query: 391 KFLKPFAIIMQKSNPAELRELIVHYVLHMVLNRANNVKSGLKSVFM 254 +FL+PF I+MQKSN E+RELIV + MVL+R +NVKSG KSVFM Sbjct: 1128 EFLRPFVIVMQKSNTTEIRELIVRCISQMVLSRVSNVKSGWKSVFM 1173 Score = 57.4 bits (137), Expect(2) = 9e-19 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 504 LVRSRI*NVLSDFFVSLGLSGNLSVAIFVIDSLRQLAI 391 LV SRI NVLSDFFVS+GLS NLSVAIF +DSLRQLA+ Sbjct: 1075 LVWSRIWNVLSDFFVSVGLSENLSVAIFAMDSLRQLAM 1112