BLASTX nr result
ID: Papaver31_contig00044373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044373 (547 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006487083.1| PREDICTED: cyclin-dependent kinase inhibitor... 61 3e-07 ref|XP_006423046.1| hypothetical protein CICLE_v10029306mg [Citr... 61 3e-07 ref|XP_010647768.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 1e-06 ref|XP_002282040.3| PREDICTED: cyclin-dependent kinase inhibitor... 59 1e-06 emb|CBI32432.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor... 59 2e-06 ref|XP_010652818.1| PREDICTED: cyclin-dependent kinase inhibitor... 58 2e-06 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 58 2e-06 ref|XP_002518785.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 ref|XP_004505202.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 4e-06 ref|XP_011092584.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 5e-06 gb|KHN37497.1| Cyclin-dependent kinase inhibitor 7 [Glycine soja] 57 5e-06 ref|XP_010548413.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 5e-06 ref|XP_010269188.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 5e-06 ref|NP_001235878.1| uncharacterized protein LOC100306496 [Glycin... 57 5e-06 ref|XP_014508171.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 7e-06 ref|XP_011658906.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 7e-06 ref|XP_011658905.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 7e-06 gb|KGN43940.1| hypothetical protein Csa_7G073750 [Cucumis sativus] 57 7e-06 >ref|XP_006487083.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Citrus sinensis] gi|641823033|gb|KDO42483.1| hypothetical protein CISIN_1g028984mg [Citrus sinensis] gi|641823034|gb|KDO42484.1| hypothetical protein CISIN_1g028984mg [Citrus sinensis] Length = 200 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRLTE 109 +AAEK+EQ+RF+E+YN+D V +LP+EGRY+WVRL E Sbjct: 162 TAAEKREQERFAEKYNYDIVNDLPLEGRYQWVRLNE 197 >ref|XP_006423046.1| hypothetical protein CICLE_v10029306mg [Citrus clementina] gi|557524980|gb|ESR36286.1| hypothetical protein CICLE_v10029306mg [Citrus clementina] Length = 200 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRLTE 109 +AAEK+EQ+RF+E+YN+D V +LP+EGRY+WVRL E Sbjct: 162 TAAEKREQERFAEKYNYDIVNDLPLEGRYQWVRLNE 197 >ref|XP_010647768.1| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X2 [Vitis vinifera] Length = 218 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 SAAEK +QQRF+E+YN+D V++ PMEGRY+WVRL Sbjct: 183 SAAEKYQQQRFAEKYNYDIVKDAPMEGRYQWVRL 216 >ref|XP_002282040.3| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X1 [Vitis vinifera] Length = 219 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 SAAEK +QQRF+E+YN+D V++ PMEGRY+WVRL Sbjct: 184 SAAEKYQQQRFAEKYNYDIVKDAPMEGRYQWVRL 217 >emb|CBI32432.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 SAAEK +QQRF+E+YN+D V++ PMEGRY+WVRL Sbjct: 199 SAAEKYQQQRFAEKYNYDIVKDAPMEGRYQWVRL 232 >ref|XP_003529390.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Glycine max] gi|734399755|gb|KHN31063.1| Cyclin-dependent kinase inhibitor 7 [Glycine soja] gi|947101766|gb|KRH50258.1| hypothetical protein GLYMA_07G211300 [Glycine max] Length = 187 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AEK EQ+RF+E+YNFD VR+LP+EGRY+WVRL Sbjct: 155 AEKYEQKRFTEKYNFDIVRDLPLEGRYQWVRL 186 >ref|XP_010652818.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform X1 [Vitis vinifera] Length = 228 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 +AAEK Q+RFSE+YN+D V+++PMEGRYEWVRL Sbjct: 193 AAAEKDVQKRFSEKYNYDIVKDVPMEGRYEWVRL 226 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 +AAEK Q+RFSE+YN+D V+++PMEGRYEWVRL Sbjct: 177 AAAEKDVQKRFSEKYNYDIVKDVPMEGRYEWVRL 210 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform X2 [Vitis vinifera] Length = 227 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 +AAEK Q+RFSE+YN+D V+++PMEGRYEWVRL Sbjct: 192 AAAEKDVQKRFSEKYNYDIVKDVPMEGRYEWVRL 225 >ref|XP_002518785.1| conserved hypothetical protein [Ricinus communis] gi|223542166|gb|EEF43710.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/32 (68%), Positives = 31/32 (96%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AEKKEQ+RF+++YN+D V++LP+EGRY+WVRL Sbjct: 169 AEKKEQKRFADKYNYDIVKDLPLEGRYQWVRL 200 >ref|XP_004505202.1| PREDICTED: cyclin-dependent kinase inhibitor 4 [Cicer arietinum] Length = 197 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AE++EQ+RF+E+YNFD VR +P+EGRYEWVRL Sbjct: 165 AEREEQKRFAEKYNFDIVRGMPLEGRYEWVRL 196 >ref|XP_011092584.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Sesamum indicum] gi|747089860|ref|XP_011092585.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Sesamum indicum] Length = 191 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/34 (64%), Positives = 32/34 (94%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 +AAEK EQ+RF+E+YN+D V+++P+EGRY+WVRL Sbjct: 156 AAAEKYEQKRFAEKYNYDIVKDVPLEGRYQWVRL 189 >gb|KHN37497.1| Cyclin-dependent kinase inhibitor 7 [Glycine soja] Length = 163 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AEK E++RF+E+YNFD VR+LP+EGRY+WVRL Sbjct: 131 AEKYERKRFTEKYNFDIVRDLPLEGRYQWVRL 162 >ref|XP_010548413.1| PREDICTED: cyclin-dependent kinase inhibitor 1 [Tarenaya hassleriana] Length = 222 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRLTE 109 SAAEK+ +++SE+YNFDF++E P EGRYEWV+L++ Sbjct: 187 SAAEKQHHEKYSEKYNFDFLKEKPCEGRYEWVKLSQ 222 >ref|XP_010269188.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Nelumbo nucifera] Length = 225 Score = 57.0 bits (136), Expect = 5e-06 Identities = 21/34 (61%), Positives = 32/34 (94%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 SAAEK EQ+RF+++YN+D V+++P+EGRYEW+R+ Sbjct: 190 SAAEKLEQKRFADKYNYDIVKDVPLEGRYEWIRI 223 >ref|NP_001235878.1| uncharacterized protein LOC100306496 [Glycine max] gi|255628711|gb|ACU14700.1| unknown [Glycine max] gi|947122953|gb|KRH71159.1| hypothetical protein GLYMA_02G133700 [Glycine max] Length = 176 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AEK E++RF+E+YNFD VR+LP+EGRY+WVRL Sbjct: 144 AEKYERKRFTEKYNFDIVRDLPLEGRYQWVRL 175 >ref|XP_014508171.1| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X2 [Vigna radiata var. radiata] Length = 181 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 8 AEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 AEK EQ+RF E+YNFD VR++P+EGRY+WVRL Sbjct: 149 AEKYEQKRFVEKYNFDIVRDMPLEGRYQWVRL 180 >ref|XP_011658906.1| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X2 [Cucumis sativus] Length = 295 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 S AEK EQ+RFSE+YNFD + ++P+EGRY+W+RL Sbjct: 260 SEAEKYEQKRFSEKYNFDIIMDVPLEGRYQWIRL 293 >ref|XP_011658905.1| PREDICTED: cyclin-dependent kinase inhibitor 7 isoform X1 [Cucumis sativus] Length = 297 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 S AEK EQ+RFSE+YNFD + ++P+EGRY+W+RL Sbjct: 262 SEAEKYEQKRFSEKYNFDIIMDVPLEGRYQWIRL 295 >gb|KGN43940.1| hypothetical protein Csa_7G073750 [Cucumis sativus] Length = 299 Score = 56.6 bits (135), Expect = 7e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 2 SAAEKKEQQRFSERYNFDFVRELPMEGRYEWVRL 103 S AEK EQ+RFSE+YNFD + ++P+EGRY+W+RL Sbjct: 264 SEAEKYEQKRFSEKYNFDIIMDVPLEGRYQWIRL 297