BLASTX nr result
ID: Papaver31_contig00044012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00044012 (591 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010653334.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010253075.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 ref|XP_002323670.2| hypothetical protein POPTR_0016s14370g [Popu... 72 2e-10 ref|XP_011002598.1| PREDICTED: putative pentatricopeptide repeat... 72 3e-10 ref|XP_008345572.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_008245346.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_007206949.1| hypothetical protein PRUPE_ppb018157mg [Prun... 65 3e-08 ref|XP_012091050.1| PREDICTED: putative pentatricopeptide repeat... 64 6e-08 gb|KDP21868.1| hypothetical protein JCGZ_00655 [Jatropha curcas] 64 6e-08 ref|XP_012481349.1| PREDICTED: pentatricopeptide repeat-containi... 64 8e-08 ref|XP_010683486.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_006842489.2| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 gb|ERN04164.1| hypothetical protein AMTR_s00077p00087500 [Ambore... 63 1e-07 gb|KNA19475.1| hypothetical protein SOVF_061280 [Spinacia oleracea] 62 2e-07 ref|XP_010043220.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 gb|KCW88349.1| hypothetical protein EUGRSUZ_A00738 [Eucalyptus g... 60 6e-07 ref|XP_007033528.1| Pentatricopeptide repeat superfamily protein... 60 6e-07 gb|KJB27678.1| hypothetical protein B456_005G004200 [Gossypium r... 60 8e-07 ref|XP_009765667.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-06 >ref|XP_010653334.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Vitis vinifera] Length = 545 Score = 79.3 bits (194), Expect = 1e-12 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G +DE +LVLM G +++ YNLLIDEFN++ RWL AC VYG ALKRGV+P++ Sbjct: 472 CSEGRVDEALSILVLMCEGRRIPSRICYNLLIDEFNQQGRWLSACTVYGAALKRGVIPHK 531 Query: 411 EP 406 P Sbjct: 532 RP 533 >ref|XP_010253075.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Nelumbo nucifera] Length = 623 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/66 (53%), Positives = 47/66 (71%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C+ G IDE L+LV M G +++S NLLID N++ R LDACK+YG ALKRGV P++ Sbjct: 540 CRAGRIDEALLLLVHMFRGRTTPSRISCNLLIDNLNKQGRLLDACKIYGAALKRGVTPHQ 599 Query: 411 EPKRLL 394 +PK+ L Sbjct: 600 KPKQCL 605 >ref|XP_002323670.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa] gi|550321496|gb|EEF05431.2| hypothetical protein POPTR_0016s14370g [Populus trichocarpa] Length = 424 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/64 (53%), Positives = 46/64 (71%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C G +D+ F VLVLM + +++SY+LLI E NR+ER L AC VYG AL RGVVP++ Sbjct: 361 CVGGKVDKAFYVLVLMYENSKIPSRMSYDLLIHELNRQERTLGACNVYGAALVRGVVPHK 420 Query: 411 EPKR 400 +P+R Sbjct: 421 KPRR 424 >ref|XP_011002598.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16710, mitochondrial [Populus euphratica] Length = 536 Score = 71.6 bits (174), Expect = 3e-10 Identities = 34/64 (53%), Positives = 46/64 (71%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C G +DE F VLVLM + +++SY+LLI E N++ER L AC VYG AL RGVVP++ Sbjct: 473 CVAGKVDEAFYVLVLMYENSKIPSRMSYDLLIHELNQQERTLCACNVYGAALVRGVVPHK 532 Query: 411 EPKR 400 +P+R Sbjct: 533 KPRR 536 >ref|XP_008345572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Malus domestica] gi|658040276|ref|XP_008355736.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Malus domestica] Length = 506 Score = 67.0 bits (162), Expect = 7e-09 Identities = 30/64 (46%), Positives = 43/64 (67%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G + E LVL +M G ++SYN +I E NR+ +L AC VYG ALKRGV+PN+ Sbjct: 443 CVEGKVFEALLVLSIMFEGGRATGRVSYNPVIQELNRQGSFLGACSVYGAALKRGVIPNK 502 Query: 411 EPKR 400 +P++ Sbjct: 503 KPQQ 506 >ref|XP_008245346.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16640, mitochondrial-like [Prunus mume] Length = 523 Score = 67.0 bits (162), Expect = 7e-09 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G + E LVL +M G N +SYN LI NRR +L AC VYG ALKRGV+PN Sbjct: 460 CVEGKVTEALLVLSIMYEGGRGTNGISYNPLIHGLNRRGSFLGACSVYGAALKRGVIPNT 519 Query: 411 EPKR 400 +P++ Sbjct: 520 KPQQ 523 >ref|XP_011095140.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62680, mitochondrial-like [Sesamum indicum] Length = 488 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C G +D+ VL+LM + + + +N+LIDE N++ R L+AC+VYGVALKRGVVP R Sbjct: 412 CCVGEVDKALAVLMLMHKDR-KPSGIPFNILIDELNQQGRSLEACRVYGVALKRGVVPTR 470 Query: 411 EPKRLLEE 388 +P L E Sbjct: 471 KPTYCLAE 478 >ref|XP_007206949.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica] gi|462402591|gb|EMJ08148.1| hypothetical protein PRUPE_ppb018157mg [Prunus persica] Length = 412 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/64 (48%), Positives = 40/64 (62%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G + E LVL +M G N +SY LI NRR +L AC VYG ALKRGV+PN Sbjct: 349 CVEGKVTEALLVLSIMYEGGRGTNGISYKPLIHGLNRRGSFLGACSVYGAALKRGVIPNT 408 Query: 411 EPKR 400 +P++ Sbjct: 409 KPQQ 412 >ref|XP_012091050.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g09680 [Jatropha curcas] Length = 494 Score = 63.9 bits (154), Expect = 6e-08 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C KG +++ LVLVLM + N SY+L+I E NR+ R+L A VYG AL RGVVPN+ Sbjct: 424 CTKGRVEKAILVLVLMYETHKIPNTTSYDLMIQELNRQRRFLGASNVYGSALVRGVVPNQ 483 Query: 411 EP 406 P Sbjct: 484 MP 485 >gb|KDP21868.1| hypothetical protein JCGZ_00655 [Jatropha curcas] Length = 442 Score = 63.9 bits (154), Expect = 6e-08 Identities = 32/62 (51%), Positives = 41/62 (66%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C KG +++ LVLVLM + N SY+L+I E NR+ R+L A VYG AL RGVVPN+ Sbjct: 372 CTKGRVEKAILVLVLMYETHKIPNTTSYDLMIQELNRQRRFLGASNVYGSALVRGVVPNQ 431 Query: 411 EP 406 P Sbjct: 432 MP 433 >ref|XP_012481349.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Gossypium raimondii] Length = 484 Score = 63.5 bits (153), Expect = 8e-08 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G I E +VLV M ++ SY++L+ EFNR+ L AC VYG ALK+GVVP+R Sbjct: 415 CIEGKIHEALVVLVTMYENGKIPSRTSYDMLVKEFNRQGLLLGACNVYGAALKQGVVPHR 474 Query: 411 EPKRL 397 P RL Sbjct: 475 IPLRL 479 >ref|XP_010683486.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Beta vulgaris subsp. vulgaris] gi|870854776|gb|KMT06524.1| hypothetical protein BVRB_7g156980 [Beta vulgaris subsp. vulgaris] Length = 547 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/62 (48%), Positives = 41/62 (66%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G I + LVLVL+ +K+S+N LI+EFNR+ L AC VYG ALK GV+P++ Sbjct: 478 CDEGKISQALLVLVLVFEAGKFPSKISFNFLIEEFNRQGNVLGACNVYGAALKVGVIPHQ 537 Query: 411 EP 406 P Sbjct: 538 MP 539 >ref|XP_006842489.2| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Amborella trichopoda] Length = 502 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C KG +D+ VL LM +K +YN+LI EFN+ R DA ++Y ALKRGVVP++ Sbjct: 425 CSKGRVDDAMDVLKLMFERETSPSKAAYNILIREFNQSGRVFDASRLYAKALKRGVVPHQ 484 Query: 411 EPKRLL 394 +P +L Sbjct: 485 QPAEIL 490 >gb|ERN04164.1| hypothetical protein AMTR_s00077p00087500 [Amborella trichopoda] Length = 334 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/66 (45%), Positives = 42/66 (63%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C KG +D+ VL LM +K +YN+LI EFN+ R DA ++Y ALKRGVVP++ Sbjct: 257 CSKGRVDDAMDVLKLMFERETSPSKAAYNILIREFNQSGRVFDASRLYAKALKRGVVPHQ 316 Query: 411 EPKRLL 394 +P +L Sbjct: 317 QPAEIL 322 >gb|KNA19475.1| hypothetical protein SOVF_061280 [Spinacia oleracea] Length = 478 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C++G I + VLV++ +K+SYN+LIDEFNR+ L AC VYG ALK G++P++ Sbjct: 408 CEEGKISKALSVLVVVCEAGKIPSKISYNILIDEFNRQGFLLGACSVYGAALKLGMIPHQ 467 Query: 411 EP 406 P Sbjct: 468 MP 469 >ref|XP_010043220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04760, chloroplastic-like [Eucalyptus grandis] Length = 540 Score = 60.5 bits (145), Expect = 6e-07 Identities = 29/63 (46%), Positives = 45/63 (71%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C++G + + VL+ G+ +K YN++I+EFNR+ RWL AC VYG+ALK+GVVP + Sbjct: 468 CREGKLGKALSVLMDERLGH--PSKEVYNVIINEFNRQGRWLCACNVYGMALKQGVVPEK 525 Query: 411 EPK 403 +P+ Sbjct: 526 KPE 528 >gb|KCW88349.1| hypothetical protein EUGRSUZ_A00738 [Eucalyptus grandis] Length = 409 Score = 60.5 bits (145), Expect = 6e-07 Identities = 29/63 (46%), Positives = 45/63 (71%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C++G + + VL+ G+ +K YN++I+EFNR+ RWL AC VYG+ALK+GVVP + Sbjct: 337 CREGKLGKALSVLMDERLGH--PSKEVYNVIINEFNRQGRWLCACNVYGMALKQGVVPEK 394 Query: 411 EPK 403 +P+ Sbjct: 395 KPE 397 >ref|XP_007033528.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508712557|gb|EOY04454.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 523 Score = 60.5 bits (145), Expect = 6e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G I E +VLV+M ++ SY++L+ EFN + R L A VYG ALK+GVVP+R Sbjct: 444 CTEGKIREALVVLVIMYESGKIPSRTSYDILVKEFNHQGRLLGASNVYGAALKQGVVPHR 503 Query: 411 EPKR 400 P R Sbjct: 504 IPLR 507 >gb|KJB27678.1| hypothetical protein B456_005G004200 [Gossypium raimondii] Length = 480 Score = 60.1 bits (144), Expect = 8e-07 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G I E +VLV M ++ SY++L+ EFNR+ L AC VYG ALK+GVV +R Sbjct: 415 CIEGKIHEALVVLVTMYENGKIPSRTSYDMLVKEFNRQGLLLGACNVYGAALKQGVVQHR 474 Query: 411 EPKRL 397 P RL Sbjct: 475 IPIRL 479 >ref|XP_009765667.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63150-like [Nicotiana sylvestris] Length = 512 Score = 57.8 bits (138), Expect = 4e-06 Identities = 26/63 (41%), Positives = 42/63 (66%) Frame = -1 Query: 591 CKKGMIDEGFLVLVLMVSGNIRANKLSYNLLIDEFNRRERWLDACKVYGVALKRGVVPNR 412 C +G +D+ LV +LM+ + + ++LLI+E N++ + L AC +YGVALK GVVP Sbjct: 425 CLEGKVDKALLVFILMLKVGKSTSSVPFSLLINELNQQGKPLTACYLYGVALKSGVVPRN 484 Query: 411 EPK 403 +P+ Sbjct: 485 KPE 487