BLASTX nr result
ID: Papaver31_contig00042639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver31_contig00042639 (879 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW68383.1| hypothetical protein EUGRSUZ_F02036 [Eucalyptus g... 64 2e-07 gb|KCW68382.1| hypothetical protein EUGRSUZ_F02036 [Eucalyptus g... 64 2e-07 ref|XP_010061435.1| PREDICTED: probable 28S rRNA (cytosine(4447)... 64 2e-07 ref|XP_012464131.1| PREDICTED: probable 28S rRNA (cytosine(4447)... 63 3e-07 gb|KJB81596.1| hypothetical protein B456_013G151300 [Gossypium r... 63 3e-07 ref|XP_006857786.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltr... 63 3e-07 ref|XP_010644605.1| PREDICTED: probable 28S rRNA (cytosine(4447)... 62 4e-07 ref|XP_010545285.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltr... 62 4e-07 gb|KCW82381.1| hypothetical protein EUGRSUZ_C03787 [Eucalyptus g... 62 4e-07 ref|XP_010049640.1| PREDICTED: probable 28S rRNA (cytosine(4447)... 62 4e-07 emb|CBI39768.3| unnamed protein product [Vitis vinifera] 62 4e-07 ref|XP_002266863.2| PREDICTED: probable 28S rRNA (cytosine(4447)... 62 4e-07 emb|CAN71575.1| hypothetical protein VITISV_037193 [Vitis vinifera] 62 4e-07 gb|KHG25344.1| Putative ribosomal RNA methyltransferase NOP2 [Go... 62 6e-07 ref|XP_010276276.1| PREDICTED: probable 28S rRNA (cytosine(4447)... 62 7e-07 ref|XP_010276275.1| PREDICTED: probable 28S rRNA (cytosine-C(5))... 62 7e-07 ref|XP_008646181.1| PREDICTED: putative ribosomal RNA methyltran... 61 1e-06 ref|NP_001130579.1| hypothetical protein [Zea mays] gi|194689536... 61 1e-06 ref|XP_004953749.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltr... 61 1e-06 gb|AFW73209.1| hypothetical protein ZEAMMB73_133498, partial [Ze... 61 1e-06 >gb|KCW68383.1| hypothetical protein EUGRSUZ_F02036 [Eucalyptus grandis] Length = 595 Score = 63.5 bits (153), Expect = 2e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALKRR Sbjct: 424 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKRR 462 >gb|KCW68382.1| hypothetical protein EUGRSUZ_F02036 [Eucalyptus grandis] Length = 613 Score = 63.5 bits (153), Expect = 2e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALKRR Sbjct: 424 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKRR 462 >ref|XP_010061435.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase [Eucalyptus grandis] gi|629102912|gb|KCW68381.1| hypothetical protein EUGRSUZ_F02036 [Eucalyptus grandis] Length = 632 Score = 63.5 bits (153), Expect = 2e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALKRR Sbjct: 424 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKRR 462 >ref|XP_012464131.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase [Gossypium raimondii] Length = 566 Score = 62.8 bits (151), Expect = 3e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIM+P +EA++DYALK+R Sbjct: 428 AAIDMVDANSKSGGYIVYSTCSIMVPENEAVSDYALKKR 466 >gb|KJB81596.1| hypothetical protein B456_013G151300 [Gossypium raimondii] Length = 570 Score = 62.8 bits (151), Expect = 3e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIM+P +EA++DYALK+R Sbjct: 432 AAIDMVDANSKSGGYIVYSTCSIMVPENEAVSDYALKKR 470 >ref|XP_006857786.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltransferase nop2 [Amborella trichopoda] gi|548861882|gb|ERN19253.1| hypothetical protein AMTR_s00061p00211510 [Amborella trichopoda] Length = 671 Score = 62.8 bits (151), Expect = 3e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EAI DYALK+R Sbjct: 421 AAIDMVDANSKTGGYIVYSTCSIMIPENEAIIDYALKKR 459 >ref|XP_010644605.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase isoform X2 [Vitis vinifera] Length = 619 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 427 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKKR 465 >ref|XP_010545285.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltransferase nop2 [Tarenaya hassleriana] Length = 659 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 432 AAIDMVDANSKTGGYIVYSTCSIMIPENEAVIDYALKKR 470 >gb|KCW82381.1| hypothetical protein EUGRSUZ_C03787 [Eucalyptus grandis] Length = 611 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYAL+RR Sbjct: 422 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALRRR 460 >ref|XP_010049640.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase [Eucalyptus grandis] gi|629117705|gb|KCW82380.1| hypothetical protein EUGRSUZ_C03787 [Eucalyptus grandis] Length = 630 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYAL+RR Sbjct: 422 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALRRR 460 >emb|CBI39768.3| unnamed protein product [Vitis vinifera] Length = 208 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 68 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKKR 106 >ref|XP_002266863.2| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase isoform X1 [Vitis vinifera] gi|731433333|ref|XP_010644606.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase isoform X1 [Vitis vinifera] Length = 633 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 427 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKKR 465 >emb|CAN71575.1| hypothetical protein VITISV_037193 [Vitis vinifera] Length = 741 Score = 62.4 bits (150), Expect = 4e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 429 AAIDMVDANSKSGGYIVYSTCSIMIPENEAVIDYALKKR 467 >gb|KHG25344.1| Putative ribosomal RNA methyltransferase NOP2 [Gossypium arboreum] Length = 621 Score = 62.0 bits (149), Expect = 6e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA+S GGYIVYSTCSIM+P +EA+ DYALK+R Sbjct: 426 AAIDMVDANSKSGGYIVYSTCSIMVPENEAVIDYALKKR 464 >ref|XP_010276276.1| PREDICTED: probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase isoform X2 [Nelumbo nucifera] Length = 506 Score = 61.6 bits (148), Expect = 7e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA S GGYIVYSTCSIM+P +EA+ DYALK+R Sbjct: 410 AAIDMVDAKSKSGGYIVYSTCSIMVPENEAVIDYALKKR 448 >ref|XP_010276275.1| PREDICTED: probable 28S rRNA (cytosine-C(5))-methyltransferase isoform X1 [Nelumbo nucifera] Length = 615 Score = 61.6 bits (148), Expect = 7e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI MVDA S GGYIVYSTCSIM+P +EA+ DYALK+R Sbjct: 410 AAIDMVDAKSKSGGYIVYSTCSIMVPENEAVIDYALKKR 448 >ref|XP_008646181.1| PREDICTED: putative ribosomal RNA methyltransferase nop2 [Zea mays] Length = 715 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI +VDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 457 AAIDLVDANSKTGGYIVYSTCSIMIPENEAVIDYALKKR 495 >ref|NP_001130579.1| hypothetical protein [Zea mays] gi|194689536|gb|ACF78852.1| unknown [Zea mays] gi|413923706|gb|AFW63638.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_244854 [Zea mays] Length = 718 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI +VDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 457 AAIDLVDANSKTGGYIVYSTCSIMIPENEAVIDYALKKR 495 >ref|XP_004953749.1| PREDICTED: 25S rRNA (cytosine-C(5))-methyltransferase nop2-like [Setaria italica] gi|944267049|gb|KQL31289.1| hypothetical protein SETIT_016463mg [Setaria italica] Length = 721 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI +VDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 457 AAIDLVDANSKTGGYIVYSTCSIMIPENEAVIDYALKKR 495 >gb|AFW73209.1| hypothetical protein ZEAMMB73_133498, partial [Zea mays] Length = 275 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 161 AAIGMVDASSTPGGYIVYSTCSIMIP*DEAITDYALKRR 45 AAI +VDA+S GGYIVYSTCSIMIP +EA+ DYALK+R Sbjct: 209 AAIDLVDANSKTGGYIVYSTCSIMIPENEAVIDYALKKR 247